SecReT6
Effector Protein ID: 383497791
-
SecReT6 ID560
T6SS typeA3
Gene symbol-
Locus tagUMN798_3404
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]3310777..3311262 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDH8LY33
KEGG IDsef:UMN798_3404
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|383497791|ref|YP_005398480.1| hypothetical protein UMN798_3404 [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKS
DGAQQESRTSVWDLAMNQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|383494824|ref|NC_017046.1|:c3311262-3310777 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAGCAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGAACCAGATAGGGAAATGA