SecReT6
Effector Protein ID: 384121310
-
SecReT6 ID569
T6SS typeA2
Gene symbol-
Locus tagYPD4_0718
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]922440..922931 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD0JG59
KEGG IDypd:YPD4_1305, ypd:YPD4_0718
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|384121310|ref|YP_005503930.1| hypothetical protein YPD4_0718 [Yersinia pestis D106004]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWTFKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|384120592|ref|NC_017154.1|:922440-922931 Yersinia pestis D106004 chromosome, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTGC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGACCATAACCTGTACATCCCAACCGATAACAATAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCGTATTCACCAAAGAAATCGATGCGTCGACCCCG
TACCTGTACAAAGCGGTGACCACCGGTCAGACACTGAAAACCGCCGAGTTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAATATTTCAACACCAAACTGGAAAACGTCAAAGTGGTTAAAGTTGCGCCGAA
AATGCACGACGTGAAAGATCCGGCGAAAGAGAAGCACAACCACCTGGAACTGGTGGAACTGCGCTACGAA
AAAATCACCTGGACCTTTAAAGACGGCAACATCATTCATTCCGATTCGTGGAACGAGCGCGCCACCGCAT
AG