SecReT6
Effector Protein ID: 384123849
-
SecReT6 ID800
T6SS typeA1
Gene symbol-
Locus tagYPD4_3262
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]4128846..4129364 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDD0JIT7
KEGG IDypd:YPD4_3262
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|384123849|ref|YP_005506469.1| hypothetical protein YPD4_3262 [Yersinia pestis D106004]
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPSGQRAHKPLRF
TVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQ
LVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|384120592|ref|NC_017154.1|:4128846-4129364 Yersinia pestis D106004 chromosome, complete genome
ATGCCAACTCCAGCTTATATCTCTATCACAGGGAAAACGCAGGGCAATATTACCGCAGGTGCTTTCACAG
CTGAATCCGTCGGTAATATCTATGTTCAAGGTCATGAAGACGAAATGTTGGTACAGGAGTTTGAGCACAT
TGTGACGGTGCCTACCGATCCTCAATCCGGCCAGCCTTCCGGCCAACGTGCGCACAAACCATTGCGTTTC
ACTGTTGCGTACAACAAAGCCGTTCCATTGCTGTATAACGCATTAGCCTCTGGTGAAATGCTGCCAACAG
TGGAATTGAAGTGGTACCGCACCTCGATTGAAGGCAAACAAGAGCATTTCTTCACGACTAAACTGGAAGA
TGCCACCATTATCGACATTGATTGTAAAATGCCGCATTGTCAGGATTCCACCAAGGCTGAGTTTACTCAA
TTAGTCCGTGTATCACTGGCATACCGCAAGATTAACTGGGATCACACCACCGCGGGCACCTCTGGTGCTG
ATGACTGGCGTGCGCCGATCGAAGCGTAA