SecReT6
Effector Protein ID: 384137030
-
SecReT6 ID579
T6SS typeA2
Gene symbol-
Locus tagA1122_00115
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]24737..25228 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDG0JCQ5
KEGG IDypt:A1122_00115, ypt:A1122_18575
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-36, Aligned region: 6..146
Protein Sequence: 163 a.a.     [Download]
>gi|384137030|ref|YP_005519732.1| hypothetical protein A1122_00115 [Yersinia pestis A1122]
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFVFTKEIDASTP
YLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWTFKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|384137007|ref|NC_017168.1|:24737-25228 Yersinia pestis A1122 chromosome, complete genome
ATGGCAATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAGGGTTCTGTTGATGTGC
AAAGCCGTGAAGGCAGCATTGAGATCGTGGCACAGGACCATAACCTGTACATCCCAACCGATAACAATAC
CGGCAAACTGACCGGTACCCGTATCCACACCCCGTTCGTATTCACCAAAGAAATCGATGCGTCGACCCCG
TACCTGTACAAAGCGGTGACCACCGGTCAGACACTGAAAACCGCCGAGTTCAAATGGTACCGCATTGATG
ACGCTGGCCAGGAAGTTGAATATTTCAACACCAAACTGGAAAACGTCAAAGTGGTTAAAGTTGCGCCGAA
AATGCACGACGTGAAAGATCCGGCGAAAGAGAAGCACAACCACCTGGAACTGGTGGAACTGCGCTACGAA
AAAATCACCTGGACCTTTAAAGACGGCAACATCATTCATTCCGATTCTTGGAATGAGCGCGCCACCGCAT
AG