SecReT6
Effector Protein ID: 384138439
-
SecReT6 ID581
T6SS typeA1
Gene symbol-
Locus tagA1122_07330
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]1619087..1619605 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDG0JDX5
KEGG IDypt:A1122_07330
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|384138439|ref|YP_005521141.1| hypothetical protein A1122_07330 [Yersinia pestis A1122]
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPSGQRAHKPLRF
TVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQ
LVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c1619605-1619087 Yersinia pestis A1122 chromosome, complete genome
ATGCCAACTCCAGCTTATATCTCTATCACAGGGAAAACGCAGGGCAATATTACCGCAGGTGCTTTCACAG
CTGAATCCGTCGGTAATATCTATGTTCAAGGTCATGAAGACGAAATGTTGGTACAGGAGTTTGAGCACAT
TGTGACGGTGCCTACCGATCCTCAATCCGGCCAGCCTTCCGGCCAACGTGCGCACAAACCATTGCGTTTC
ACTGTTGCGTACAACAAAGCCGTTCCATTGCTGTATAACGCATTAGCCTCTGGTGAAATGCTGCCAACAG
TGGAATTGAAGTGGTACCGCACCTCGATTGAAGGCAAACAAGAGCATTTCTTCACGACTAAACTGGAAGA
TGCCACCATTATCGACATTGATTGTAAAATGCCGCATTGTCAGGATTCCACCAAGGCTGAGTTTACTCAA
TTAGTCCGTGTATCACTGGCATACCGCAAGATTAACTGGGATCACACCACCGCGGGCACCTCTGGTGCTG
ATGACTGGCGTGCGCCGATCGAAGCGTAA