SecReT6
Effector Protein ID: 384139216
-
SecReT6 ID582
T6SS typeA3
Gene symbol-
Locus tagA1122_11290
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2481658..2482143 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDG0JA83
KEGG IDypt:A1122_11290
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|384139216|ref|YP_005521918.1| Hcp1 family type VI secretion system effector [Yersinia pestis A1122]
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLL
SYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|384137007|ref|NC_017168.1|:2481658-2482143 Yersinia pestis A1122 chromosome, complete genome
ATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGCCAATCACAAAAACG
AAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGCGGTTCAGGTGGCGG
TTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGCTGGTGGCGATCCGC
TGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCGGGTTCTTTGGAAGA
TGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACTATGTTATGCAGAAT
GCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACATGCACAGCTAA