SecReT6
Effector Protein ID: 384422552
-
SecReT6 ID596
T6SS typeA1
Gene symbol-
Locus tagVCLMA_B0017
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]21049..24309 [+]
Productmembrane protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDF2ITD8
KEGG IDvcl:VCLMA_B0017
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1086 a.a.     [Download]
>gi|384422552|ref|YP_005631911.1| membrane protein [Vibrio cholerae LMA3984-4]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPTERDIFKDTCTPSL
PVEKSEEAVNGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAVGD
ETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESYALASEGLAPSG
NYAFMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALA
STGFSLQANQAINNHIQGFSTAFLSTSSPSDMVAFSTAIANWDTFTGDGRIQEKAWFKKWIEPVQSSFSA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKL
NAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGA
ISAGRAWVTIAEQGFLRLSLERAFDEASSLKAKDALKTFSKSIALVATVGMIASGLEAWESWGKFNDSSK
TDLERFGYLLKAGATGAQALIFAIQLGVYGVSRFIGFGTIAAISAGWMAAGFAVIGIVYLIGVILTNVFK
RSELEIWLLKSTWGKESAHWPVGQELTELERLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLK
GQTIGLQITRLPAQPAYYQRQMEAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLHWVK
EQSLKFCARGTRVGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3261 bp     [Download]
>gi|384422536|ref|NC_017269.1|:21049-24309 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCA
AGCATTACATCCTTTACCCAAAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTAC
ACTTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGATGATGAGGCAAACAAACCCACTCACGAGCG
CGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACACGCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCATGCTGTGATGC
GAAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCGCATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAACTGAGCGGGATATTTTTAAAGATACCTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGTGAACGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTGA
GCAGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTGTTACTTTTACTACCCAAGTGGCAAAGCGAACTAAAGCGGTTGGTGAT
GAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTAGAAAGAGCCATAACTGAATA
TTGTGCTACGGCAAAATTGGCCGAAATCGAATCTTATGCTTTAGCCAGTGAAGGGCTTGCCCCATCGGGA
AACTATGCCTTCATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACTGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATG
AGGTTCAGCAAGCGTATTTGTTAGCATTAACTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGA
TGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTTGATTCACCGAAAAACCTCATGGCCCTCGCG
TCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCAAGGGTTTAGCACCGCTTTTC
TCTCTACAAGTAGTCCTAGTGATATGGTGGCGTTTTCGACTGCAATCGCTAACTGGGATACGTTCACGGG
GGATGGACGTATTCAGGAGAAAGCATGGTTTAAGAAATGGATTGAACCCGTTCAATCGAGTTTTAGTGCA
CTGCAAAAAGCGGTTGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATC
AGAATCAGCCCAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGT
TCGAGAAGAGGCGGTGCTGCAACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTG
AATGCCATTTTGCAAGAGATGAATGATGCTCTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAGCTGCCGATGATGCT
GACGCTCAAAAACCAAGCGGCGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGCTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCGT
TGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCC
ATTAGTGCTGGGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTTTTAAGGTTATCTCTTGAAAGAGCAT
TCGATGAAGCATCAAGCCTTAAAGCTAAAGATGCCCTAAAAACTTTTTCTAAATCGATCGCCTTGGTGGC
TACCGTTGGCATGATTGCCAGCGGGTTAGAGGCATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTATTAAAAGCAGGGGCAACGGGAGCACAGGCTCTGATTTTTGCTA
TTCAGTTAGGTGTATACGGAGTAAGTCGATTCATAGGTTTTGGAACAATCGCAGCCATCAGTGCTGGTTG
GATGGCCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAA
CGCTCAGAGTTAGAAATTTGGTTATTAAAATCGACGTGGGGCAAAGAGAGTGCTCATTGGCCAGTGGGCC
AAGAATTGACCGAGTTAGAGCGCCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAA
AGCAGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTAGAACTCACGTTACCCGATTATCTTAAA
GGGCAGACGATAGGCTTGCAAATAACCCGTTTGCCAGCGCAGCCGGCATATTATCAACGGCAAATGGAGG
CGGTAACACCAATACTCATCAATGAACAACAGGGAAAATGGAGTATTGAAGATAATCAGCCAGTGTATCG
CATCACATTGGGTGGCAGTGAGAAGGATACCGTTGGTGTTTGCGTTGCACTGCCCCTGCACTGGGTCAAG
GAACAGAGTCTCAAATTTTGCGCCCGCGGAACTCGCGTGGGGGAATTAGATTTACAATCTGCAGAGGCGA
ATGATATTGCCACAAGAAATCTCGTTGTAGGAAAGGGTTAA