SecReT6
Effector Protein ID: 384422638
-
SecReT6 ID596
T6SS typeA1
Gene symbol-
Locus tagVCLMA_B0106
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]127754..128410 [+]
ProductType VI secretion protein VasI
Effector typeProtein
Homologous effectorVCA0118
Description
UniProt IDF2ISC9
KEGG IDvcl:VCLMA_B0106
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 3.50E-59, Aligned region: 32..212
Protein Sequence: 218 a.a.     [Download]
>gi|384422638|ref|YP_005631997.1| Type VI secretion protein VasI [Vibrio cholerae LMA3984-4]
MRITVLVASLILGCAGSAHVLAASQAAGSQVEQAELCREIPVRLERLACFDRVFATPLEQVAIAPSNPYP
AEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEV
ADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASEPRLLLRSNAPFADGLQFDTRGVNEALD
ALRERCGW
-
Nucleotide Sequence: 657 bp     [Download]
>gi|384422536|ref|NC_017269.1|:127754-128410 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGAGAATTACCGTTTTAGTGGCCAGTTTGATCTTGGGTTGCGCGGGCTCTGCGCATGTTCTAGCGGCCT
CGCAAGCGGCGGGATCACAGGTTGAGCAAGCTGAGCTGTGCCGCGAAATTCCTGTGCGTTTAGAGCGTTT
GGCTTGTTTTGACCGTGTCTTCGCCACGCCCCTTGAGCAAGTGGCTATCGCACCGTCCAATCCTTATCCC
GCAGAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGTCCGAAGCGGGTTGGGTTTTAGGTACGC
AAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGCGCAAAATCGCAGCTCAGGGGAAACATC
TCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGCATTGAGCTGGCTTTACCGAAAGAAGTG
GCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGTTCTGGCGCAGTGACGATCACGGCGTAC
TGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAAATTGGCCGCCAGTGAGCCTCGCCTGTT
GCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGATACTCGAGGTGTCAATGAAGCCCTTGAT
GCTTTGCGCGAACGCTGTGGTTGGTAA