SecReT6
Effector Protein ID: 384422642
-
SecReT6 ID596
T6SS typeA1
Gene symbol-
Locus tagVCLMA_B0110
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]134938..137457 [+]
ProductVgrG-3 protein
Effector typeProtein
Homologous effectorVCA0123
Descriptiontype VI secretion system Vgr family protein
UniProt IDF2ISD3
KEGG IDvcl:VCLMA_B0110
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-60, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 5.80E-25, Aligned region: 374..467
PG_binding_1 [PF01471], Evalue: 1.50E-09, Aligned region: 536..549
PG_binding_1 [PF01471], Evalue: 1.50E-09, Aligned region: 731..773
PG_binding_1 [PF01471], Evalue: 1.50E-09, Aligned region: 786..799
DUF2345 [PF10106], Evalue: 4.00E-05, Aligned region: 525..619
PG_binding_3 [PF09374], Evalue: 0.00067, Aligned region: 734..767
PG_binding_3 [PF09374], Evalue: 0.00067, Aligned region: 785..802
Protein Sequence: 839 a.a.     [Download]
>gi|384422642|ref|YP_005632001.1| VgrG-3 protein [Vibrio cholerae LMA3984-4]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRSEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTIR
RDGQVVQQINGIVRQFSKGDTGYRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYA
FALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGG
EINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFS
QIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDLAMNRDWLVVQANHQGTQPQALQEEGGSGATTYS
NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNEL
SFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGS
GSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPE
RILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQK
SYQPSHQTHPSYSIGPVDGIVGKGTLLALDEALMDGWVYENDEMDLKWLTVPKGQLTFDAEGNDVDSST
-
Nucleotide Sequence: 2520 bp     [Download]
>gi|384422536|ref|NC_017269.1|:134938-137457 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTG
AAGGGCAAGAGTCCTTGTCTGATTCTGTATGGCGCAGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGA
TTTAGCCAGTGCGCTAAGTAACCTCACGGCTGAGCAATTTGTCGACCAAACCGCGCATTTAACCATTCGG
CGTGACGGGCAAGTGGTGCAGCAAATTAACGGTATCGTACGCCAATTCAGCAAAGGCGATACTGGGTATC
GGCACACGTTTTATTCTCTTACGTTAGTACCTGCGCTGGAGCGGCTTTCTTTACGCAGTAATAGCCGTAT
TTTCCAGCAGCAAAGCGTGCCGGAAATTATCTCTATTTTGCTGCAAGAGATGGGGATTGAAGATTACGCC
TTTGCCCTTAAGCGTGAGTGTGCCCAGCGAGAGTTTTGTGTACAGTATCGTGAAACGGATTTGCAGTTTT
TACACCGAATCGCCGCCGAAGAAGGCTTGGTTTACAGCCACCTACATGAAGCGCAGAAACACACGCTACT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGC
GAGATCAATCTCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCACAAGTCAGCCATACCGAGCTAA
AGGATTACAGCTTTAAAAAGCCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGACATCGCTTATCA
GCAGCCAAATTATGAGCATTTTGATGCTCCGGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGC
CAAATTCGCTTAGAGTATTTACGCCGCGATGCTTTGCTTGCTGATGCGAAGAGTGACGAACCTTTGCTGT
TGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCTCGCAATGAATCGAGATTGGCTCGTGGTACA
AGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGTGGTTCAGGCGCTACCACTTACAGC
AATCAGCTAAAACTTATCCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCCACCGTAGTTGGGCCGCAAGGTGAAGAGATTTATTGCGATAACTTTGGTCGTGTGAA
AGTGCATTTCCCGTGGGATCGCTACTCAAGTAGCAACGAAAAAAGCTCTTGCTGGGTACGAGTGGCACAA
GAATGGGCGGGTAGCCAATACGGTAGTATGGCGATTCCGCGAGTCGGCCATGAAGTGATTGTTTCGTTCC
TGAATGGCGATCCGGATCAACCCATCATCACGGGTCGTACGTACCATGCGACCAATACCGCGCCTTACGC
CTTGCCTGACCACAAAACCAAAACCGTACTGCGCACTGAGACTCACCAAGGGCAAGGCTACAACGAACTG
AGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAAAGATTGGGATGCGTTGATTG
AGCATGATCACACCGAAGTGATTCGCCACGATCAGCATCTCACTGTGGACAATGATCGCTTTACCCGCAT
TCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTAGGGCAACGCATTGCTGTCGAGGCGGGCAAAGAGATTTCACTCA
AAAGCGGCGCAAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCAGGGGGCAGCTTTGTAAA
AGTCGATGCAGGTGGCGTGCACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGC
GGTAGCGCTTATGGTGGGCAATTAGCCGCAGCACCAAGAATGTTAGCGCAAGCTAAACCAGTAGCTGAAT
TGGTTCAGCCGGATATTGCTGCCTCAATGCAATCAGGCGCGGCGCGTGTTATTGATGTGGCATCACTCCC
CACTATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGGCCGAAGAGAAAACACCGGAG
CGAATTTTAAAATCCGATCTTCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGACAAGCGAGTG
CTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTATTACAAGAAGCGCTCATAAAACTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGCAGTAAAACTAAAACCGCGATTGAGCAGTTCCAGAAA
AGCTATCAACCAAGCCACCAAACACACCCGTCTTACAGCATTGGCCCCGTTGACGGTATTGTCGGCAAAG
GTACACTACTGGCACTAGACGAAGCCTTGATGGATGGGTGGGTGTATGAAAATGATGAGATGGATTTGAA
ATGGTTGACTGTACCCAAAGGTCAGCTCACTTTTGATGCCGAAGGGAATGATGTTGATTCATCAACTTAG