SecReT6
Effector Protein ID: 384424527
-
SecReT6 ID596
T6SS typeA1
Gene symbol-
Locus tagVCLMA_A1246
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017270] [Browse all T6SS(s) in this replicon]
Location [Strand]1410747..1411265 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDF2IQJ4
KEGG IDvcl:VCLMA_A1246
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-37, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|384424527|ref|YP_005633885.1| hypothetical protein VCLMA_A1246 [Vibrio cholerae LMA3984-4]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|384423362|ref|NC_017270.1|:1410747-1411265 Vibrio cholerae LMA3984-4 chromosome chromosome I, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGTGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
TGTGACTGTACCTACTGACCCACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCTGGTGAGAAGCTGAAGTCGG
TTGAGCTGAAGTGGTACCGTACTTCTATCGAAGGTAAACAAGAAAACTTCTTTACCACTAAGCTGGAAAA
CGCGTCTATCGTCGATATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA