SecReT6
Effector Protein ID: 384527702
-
SecReT6 ID561
T6SS typeA2
Gene symbol-
Locus tagQ7S_23361
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]127189..127680 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDH8NZZ0
KEGG IDraa:Q7S_23361
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.20E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|384527702|ref|YP_005418934.1| type VI secretion system effector [Rahnella aquatilis HX2]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPKMHDIKDPAKEKHNHLEAIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|384527587|ref|NC_017060.1|:127189-127680 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGCAATTCCTGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGCTCCGTAGACGTTA
AAGATCGCGAAGGCAGCATCGAAGTGGTTGCACAGGATCACAACCTGTATATCCCGACCGATAACAACAC
CGGCAAACTGACGGGTACTCGTATTCACACCCCGTTCCTGTTTACCAAAGAAATCGATTCCTCCAGCCCG
TACCTGTACAAAGCGGTGACCACTGGCCAGACCCTTAAATCTGCTGAGTTCAAATGGTATCGCATCAATG
ACGCGGGCCAGGAAGTGGAGTATTTCAACACTAAACTCGAAAACGTCAAGCTGGTAAAAGTCGCGCCAAA
AATGCACGACATCAAAGATCCGGCTAAAGAGAAACACAACCACCTCGAAGCTATCGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCCTGGAACGAACGTACTACCGCGT
AA