SecReT6
Effector Protein ID: 384527765
-
SecReT6 ID562
T6SS typeN/A
Gene symbol-
Locus tagQ7S_23696
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]201204..201686 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDH8P053
KEGG IDraa:Q7S_23696
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.80E-36, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|384527765|ref|YP_005418997.1| type VI secretion system effector [Rahnella aquatilis HX2]
MAIPAYLWLKDDGGADIKGSVDVNGREGSIEVQGFGHGLFLPTDNNTGKITGTRVHSALTFEKEFDSSSP
YLYKAVAKGQTLKSAEIRWYRINDAGQEAEYFNMLMENVKVVSVCPLMHDCKNPATDKHNHLESISLRYE
RITWKHCDGNIIFSDAWNDR
-
Nucleotide Sequence: 483 bp     [Download]
>gi|384527587|ref|NC_017060.1|:201204-201686 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGGCAATACCCGCTTACCTATGGCTTAAAGATGACGGCGGCGCTGACATCAAAGGATCTGTCGATGTGA
ATGGGCGTGAGGGGAGTATCGAGGTTCAAGGATTTGGGCACGGCTTGTTTTTACCTACTGACAACAACAC
AGGCAAGATCACCGGTACTCGTGTACATTCCGCGCTGACTTTTGAAAAAGAATTCGATAGCTCTTCGCCC
TACCTTTACAAGGCCGTCGCAAAAGGCCAAACCTTAAAATCTGCGGAGATAAGGTGGTACAGGATCAACG
ATGCTGGTCAGGAAGCTGAATATTTCAATATGCTGATGGAAAATGTAAAGGTCGTTTCTGTTTGCCCGCT
AATGCATGATTGCAAAAACCCTGCCACTGATAAACATAACCATCTTGAGTCAATTTCACTGCGTTACGAG
CGGATCACGTGGAAACATTGCGATGGGAATATCATTTTTTCAGATGCGTGGAATGACAGATGA