SecReT6
Effector Protein ID: 385333624
-
SecReT6 ID604
T6SS typeA1
Gene symbol-
Locus tagHP15_3883
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]4112887..4113417 [-]
ProductHcp protein
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDE4PJT7
KEGG IDmad:HP15_3883
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-37, Aligned region: 10..159
Protein Sequence: 176 a.a.     [Download]
>gi|385333624|ref|YP_005887575.1| Hcp protein [Marinobacter adhaerens HP15]
MEQTMPTPCYISIEGQTQGNITAGAFTSDSVGNIYVEGHEDEVLVQEFSHVVTVPTDPQSGQPSGQRVHK
PFKFTSALNKATPLMYNALASGEMLPKVELKWYRTSVEGKQEHFFSTVLEDATIIDINCNMPHCQDAGNA
DFTQLVTVSLSYRKVTWEHAVAGTSGADDWRSPIEA
-
Nucleotide Sequence: 531 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c4113417-4112887 Marinobacter adhaerens HP15 chromosome, complete genome
ATGGAGCAGACTATGCCAACTCCTTGTTATATCAGCATCGAAGGCCAAACCCAGGGCAACATTACCGCCG
GCGCTTTCACTTCCGATTCCGTCGGCAACATCTACGTGGAAGGCCACGAAGACGAAGTGCTGGTGCAGGA
ATTCAGCCACGTTGTTACCGTACCGACCGATCCCCAGTCCGGTCAGCCATCCGGTCAGCGCGTTCACAAG
CCGTTCAAGTTCACGTCCGCCCTGAACAAGGCCACCCCGCTGATGTACAACGCCCTCGCCTCCGGCGAGA
TGCTGCCGAAGGTCGAACTGAAGTGGTACCGCACCTCCGTTGAGGGCAAGCAGGAGCACTTTTTCTCCAC
CGTCCTCGAAGATGCCACCATCATCGACATCAACTGCAACATGCCCCACTGCCAGGATGCCGGCAACGCC
GACTTCACCCAGCTGGTCACCGTTTCCCTGTCCTACCGCAAGGTGACCTGGGAACACGCCGTTGCCGGTA
CTTCCGGTGCTGACGACTGGCGGTCGCCGATCGAGGCCTGA