SecReT6
Effector Protein ID: 385793287
-
SecReT6 ID774
T6SS typeB
Gene symbol-
Locus tagFNFX1_1355
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1388718..1389869 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTL_0118
DescriptionIglI protein
UniProt IDF4BCN9
KEGG IDfcf:FNFX1_1355
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 383 a.a.     [Download]
>gi|385793287|ref|YP_005826263.1| hypothetical protein [Francisella cf. novicida Fx1]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNL
DTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDTNFAQMQNQDKLFPNNIDSIIE
IVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKW
KTLIEKIEVLKALVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSS
IQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIV
IKQRTNNKKNQNDSVEKISNEIDEDYFEDLFDI
-
Nucleotide Sequence: 1152 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1388718-1389869 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTA
ATATGCAAATACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCT
TAATACTACTAGAAGCATAGATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTA
GATACGGTTGATAATATCTCTAAAATTATTAGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAA
TTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGAAAAAGGAATAAACAAATTCTTAGTCACTAT
GGATACAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTTCCAAATAACATAGATTCTATTATAGAA
ATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAATTTAAATTATAATTCTGATTTTAAAATCCAAC
TAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATTCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGG
AAAACTCTTATTGAAAAAATTGAAGTTTTAAAAGCTCTAGTCGAAAGTGAAAGAATATTTGAAACATCTA
TTGTTTATAATGATATACAAAACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTT
TCCATTATACAAGAAGATAGCTCCTTTTATTGGCAATATCCATAAAAACATAGACTACTACTCATCAAGT
ATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATTATAAGAGTTTTTTAGATACTCTTGAGAAAA
TGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTCTTTTATGAAACATCCTCAGA
GGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGAAGAAATAGTA
ATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGATTCGGTAGAAAAAATTTCAAATGAGATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA