SecReT6
Effector Protein ID: 386014996
rhsD
SecReT6 ID606
T6SS typeA3
Gene symbolrhsD
Locus tagPAJ_0397
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]488026..492213 [-]
Productprotein rhsD precursor RhsD
Effector typeProtein
Homologous effectorECL_03140
DescriptionrhsB
UniProt IDF2ENX7
KEGG IDpaj:PAJ_0397
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 367..394
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 421..442
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 509..525
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 549..569
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 597..629
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 636..672
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 657..693
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 699..732
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 720..755
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 741..777
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 808..824
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 864..897
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 927..953
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 982..1006
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 998..1028
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 1074..1106
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 1133..1144
RHS_repeat [PF05593], Evalue: 4.50E-41, Aligned region: 1173..1196
PAAR_motif [PF05488], Evalue: 2.20E-16, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 2.20E-16, Aligned region: 83..155
RHS [PF03527], Evalue: 3.70E-13, Aligned region: 723..752
RHS [PF03527], Evalue: 3.70E-13, Aligned region: 760..770
RHS [PF03527], Evalue: 3.70E-13, Aligned region: 1053..1064
RHS [PF03527], Evalue: 3.70E-13, Aligned region: 1095..1102
RHS [PF03527], Evalue: 3.70E-13, Aligned region: 1165..1202
DUF4595 [PF15283], Evalue: 3.40E-05, Aligned region: 375..402
DUF4595 [PF15283], Evalue: 3.40E-05, Aligned region: 418..446
DUF4595 [PF15283], Evalue: 3.40E-05, Aligned region: 605..680
DUF4595 [PF15283], Evalue: 3.40E-05, Aligned region: 857..872
DUF4595 [PF15283], Evalue: 3.40E-05, Aligned region: 996..1089
DUF4150 [PF13665], Evalue: 0.0016, Aligned region: 83..111
DUF4150 [PF13665], Evalue: 0.0016, Aligned region: 120..155
Protein Sequence: 1395 a.a.     [Download]
>gi|386014996|ref|YP_005933273.1| protein rhsD precursor RhsD [Pantoea ananatis AJ13355]
MFEAARLGDDIGHSHALAGMIAGTIVGGLIAAAGGIAAGALMIAGIGASCLGVGVLLVGLSIGVGYLTGE
LATAARDGIADAGAASMTPKGKITTGSPNVFINSKPAAMATNSIVACKDDGPQQMAEGSSRVYINGLPAS
RIDDRTTCDAKVMTGSDNVYIGGEPEQTLPIQPEVPEWVYKASDLTLLFAGLAGGVGGAAGKVGALGKLL
SKIPGINKIARVACRAGALMTGVAAAGILARPVDIVSGQKFLSGDDELDFVLPSRLPLRWQRYWRSGNPG
DSVLGRGWNLFWETRLERYQDGLVWRASSGDYVSFPLVPKGQRTYCEAEKRWLEHHRDDSWSLYDISGER
WHFMPLRDDAPSLPLCLTEPCGNEIQFDWNPDHTLAALTDSAGQRVTCRYANNRLAGAWLDDDICLVSYA
YDDIGQLVTVTGRGGSVRRRFQWCDGLMVAHEDMNGLLSEYRWQEIDGLPRVVAFRHSGGEQLDFEYDFD
NGIRRARRDDGVEAHWLIDDDDHVARFTDFDGRQTMLVYRAGELCDVIMPGGAMRCSNWDRYGRMTQEID
PVGRRTTYHWFRMTDRVIRTDYPDLSATQAAYDLNVRLLTETDALNNVTTYHYPDDTELLPDSITDATGG
VVKLEWNRQGLLTQRTDCSGSVTTFSYDRFGQLVRSVDAEGHVTQREWNDKGQLCAIIHPDGSRETLHWN
TQGQLSAWRDPLETEVRWTYNALGLPVSLTDRIGRTRRWHYDARGNLLRLENGNGGDYRFTCDPLGRPLS
EIRPDKTSRNMEWNARGFLIGLQENGQPANDGGIARRWQRFSYDDSGLITQRTTQHAEYHYRRHRSGQLA
SLVRTPTSDGMALGIEDDEIAFTYDVAGQLLTEAGINGKLDYEWDALGNLTHLTLPGEQQLAWLHYGSGH
VSAIRFNQQLVSEFTRDRLHREIRRSQGAREQARQYDSLGRRTMQRSELHSEVVLPEKAILERAFRYSAR
SELESVSDTLRGDIIYGYDDEGRLLKHYEARQGHSTSHFAYDNADNLAANDDALHALPVTDNRLHHWQNL
FMKYDDWGNLVSRRSGLHEQHFTYDAENRLISAKGNGPDGGFTAHYHYDALGRRTRKVVSTQHDRKEVRF
LWQGYRLLQEQHENGQCQTYVYDPNEAWSPLARIDHMAAGERGDVLWFNTDLNGAPLEVTDERGDIRWSG
QYGSFGEVRRQTEGFTRLAKQSALPHQPLRYAGQYADSETGLHYNLFRYYDPQVGRFTVQDPIGLEGGWN
LYQYAPNPLSWIDPLGLNKCGSFTKNPDDIHFMQSSIKNQTGEHTVLNNAAALKNGTLKPTDLPAIKIWQ
DSSGKLWTLDHRRLAAFKLSGLKEIPVQWATEKEIAGQMWKMTTKTDGKSIILKMGDGIKRVIGG
-
Nucleotide Sequence: 4188 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c492213-488026 Pantoea ananatis AJ13355, complete genome
ATGTTTGAAGCTGCACGCCTCGGCGATGATATCGGTCACTCTCATGCCCTGGCGGGCATGATTGCAGGCA
CTATCGTCGGTGGACTGATCGCTGCGGCGGGCGGTATTGCTGCGGGTGCATTGATGATTGCCGGGATAGG
CGCCTCCTGCCTTGGCGTGGGCGTATTGCTGGTTGGACTCAGTATCGGCGTGGGTTACCTTACTGGCGAA
CTGGCCACAGCCGCGCGAGACGGAATAGCGGATGCTGGGGCGGCCAGCATGACCCCAAAGGGCAAGATTA
CCACCGGTTCGCCCAACGTCTTTATTAACAGTAAACCCGCCGCCATGGCCACCAACAGCATAGTGGCCTG
CAAGGACGATGGTCCGCAGCAGATGGCGGAAGGCTCCTCCCGGGTGTATATCAACGGCCTGCCTGCATCA
CGCATCGACGATCGCACCACCTGCGATGCCAAAGTGATGACGGGCTCTGACAACGTCTATATCGGCGGCG
AGCCTGAACAAACGCTGCCTATCCAACCTGAAGTGCCCGAATGGGTTTATAAAGCCTCCGATCTTACCCT
GCTGTTTGCCGGGCTGGCCGGTGGCGTGGGCGGTGCGGCTGGCAAGGTCGGCGCGCTGGGTAAATTACTG
AGCAAGATTCCCGGTATCAATAAAATCGCCCGGGTGGCCTGCCGTGCTGGTGCCTTGATGACCGGTGTGG
CGGCCGCAGGTATTCTTGCCCGTCCCGTTGATATCGTAAGCGGCCAGAAGTTTCTTAGCGGCGATGATGA
ACTGGATTTTGTGCTGCCCTCCCGGCTGCCGCTACGCTGGCAGCGCTACTGGCGCAGCGGTAATCCCGGC
GACAGCGTATTAGGCCGTGGCTGGAACCTGTTCTGGGAAACACGGCTGGAACGTTACCAGGATGGGCTGG
TCTGGCGTGCGTCCTCCGGCGATTACGTCTCTTTTCCTCTGGTGCCAAAAGGCCAGCGTACCTACTGCGA
AGCGGAGAAACGCTGGCTGGAACATCATCGGGACGACAGTTGGTCATTGTATGACATCAGCGGTGAGCGC
TGGCATTTTATGCCCCTGCGCGATGATGCCCCTTCTCTTCCCCTCTGCCTGACCGAGCCCTGCGGCAATG
AGATTCAGTTCGACTGGAACCCCGATCACACATTGGCTGCGCTGACAGACAGTGCCGGTCAGCGCGTAAC
CTGCCGCTATGCGAATAACCGGCTCGCAGGTGCCTGGCTGGATGACGATATTTGTCTGGTCAGTTACGCG
TATGATGATATCGGCCAACTCGTTACGGTAACGGGCCGGGGCGGTAGCGTGCGCCGACGCTTCCAGTGGT
GCGATGGCCTGATGGTCGCCCATGAAGATATGAATGGCCTGCTAAGTGAGTATCGCTGGCAGGAGATCGA
TGGCCTCCCAAGAGTGGTGGCCTTCCGTCACAGCGGCGGCGAGCAGCTGGATTTTGAGTACGATTTTGAT
AATGGCATCCGACGCGCGCGACGTGATGACGGCGTTGAAGCTCACTGGCTCATTGACGATGACGATCATG
TCGCCCGCTTTACCGACTTCGACGGCCGCCAGACCATGCTGGTTTACCGCGCAGGCGAGTTGTGCGATGT
GATTATGCCCGGCGGTGCCATGCGCTGCAGCAACTGGGACCGCTATGGTCGCATGACGCAGGAGATCGAT
CCGGTCGGACGTCGAACCACTTATCACTGGTTCCGCATGACTGACCGTGTGATCCGTACGGACTATCCCG
ATCTGAGCGCGACTCAGGCGGCTTACGATCTTAATGTTCGCCTGCTGACTGAAACCGATGCGCTCAATAA
CGTCACCACCTATCACTACCCTGATGACACAGAACTGCTGCCAGACAGCATCACCGATGCAACGGGCGGC
GTGGTGAAGCTGGAATGGAACCGACAAGGGCTGCTGACGCAGCGCACCGACTGCTCTGGCAGCGTAACGA
CGTTTAGCTACGACCGATTTGGCCAGCTTGTTCGCAGCGTGGATGCTGAAGGTCATGTCACCCAGCGCGA
GTGGAATGACAAGGGACAACTCTGCGCCATTATCCATCCAGACGGTAGCCGGGAAACCCTACACTGGAAC
ACCCAGGGGCAGCTCAGTGCGTGGCGCGATCCGCTGGAAACCGAAGTCCGCTGGACCTATAACGCACTCG
GATTACCGGTGAGCCTGACGGACCGCATTGGTCGCACGCGTCGCTGGCATTACGATGCCCGTGGTAATCT
GCTGCGGCTGGAAAACGGCAACGGCGGTGACTATCGCTTTACCTGCGATCCGCTCGGCCGTCCATTGAGT
GAGATCCGGCCCGATAAGACCTCACGCAATATGGAATGGAATGCTCGTGGCTTTCTCATTGGTTTACAGG
AAAATGGCCAGCCCGCTAATGACGGTGGCATAGCTCGACGCTGGCAGCGCTTTAGCTACGACGACAGCGG
CTTGATTACCCAGCGCACAACGCAGCATGCTGAATACCACTACCGGCGTCATCGTAGCGGTCAACTTGCC
AGCCTGGTTCGCACGCCGACCAGCGACGGAATGGCGCTTGGTATCGAAGACGATGAAATCGCCTTTACCT
ATGACGTCGCAGGTCAGCTCTTAACAGAAGCTGGTATAAACGGGAAACTGGATTACGAATGGGATGCGCT
GGGCAACCTCACCCATCTGACCCTGCCGGGTGAACAGCAACTTGCCTGGCTGCACTACGGTTCGGGTCAC
GTCAGCGCGATTCGCTTTAATCAGCAACTGGTCAGTGAATTTACCCGCGACCGCCTGCACCGGGAAATTC
GCCGCAGTCAGGGCGCGCGTGAGCAGGCGCGTCAGTACGACAGCCTTGGCAGGCGCACGATGCAGCGCAG
TGAATTGCATAGCGAGGTGGTGCTACCGGAAAAAGCCATTCTGGAACGCGCTTTCCGCTATTCGGCGCGC
AGTGAACTGGAGTCTGTCAGTGATACGCTGCGCGGCGACATTATCTATGGTTACGATGATGAAGGCCGCC
TGCTGAAGCACTACGAAGCCAGACAGGGTCACAGCACCTCGCATTTTGCTTACGATAACGCGGACAACCT
GGCGGCAAACGACGATGCACTGCACGCGTTGCCAGTTACCGACAACCGTCTGCATCACTGGCAGAACCTG
TTTATGAAGTACGATGACTGGGGCAACCTGGTCAGTCGACGCAGCGGCCTGCATGAGCAGCATTTTACCT
ATGACGCCGAAAACCGGCTCATCAGCGCCAAAGGCAATGGCCCGGACGGCGGGTTTACCGCACACTATCA
TTATGATGCGCTGGGCAGGCGCACCCGCAAAGTGGTCAGCACCCAGCACGATCGTAAAGAAGTCCGTTTT
CTGTGGCAGGGCTATCGCCTGTTACAGGAGCAGCATGAAAACGGCCAGTGCCAGACCTACGTGTACGATC
CCAACGAGGCCTGGAGCCCGCTGGCGCGCATCGACCATATGGCAGCAGGCGAACGGGGCGATGTGTTGTG
GTTCAATACCGATCTCAACGGGGCACCGCTAGAGGTAACCGATGAACGCGGCGACATCCGCTGGAGCGGT
CAGTACGGCAGCTTTGGTGAAGTGCGTCGGCAGACAGAGGGCTTTACCCGGCTGGCAAAACAGTCTGCCC
TGCCCCATCAGCCGCTGCGCTATGCGGGCCAGTATGCGGACAGCGAAACCGGTCTGCATTACAATCTGTT
CCGCTATTACGATCCGCAGGTGGGACGGTTCACGGTTCAGGACCCGATAGGGCTGGAAGGCGGCTGGAAC
CTGTATCAGTATGCGCCGAACCCGCTGAGTTGGATCGACCCGTTGGGGTTGAATAAGTGTGGGAGCTTTA
CAAAGAATCCTGACGATATCCATTTCATGCAAAGTTCAATTAAAAATCAAACGGGCGAGCATACCGTTCT
CAATAACGCAGCTGCTCTTAAAAACGGTACTCTTAAGCCCACTGATTTACCCGCAATTAAAATTTGGCAA
GACTCAAGCGGAAAATTATGGACTCTGGACCACAGGAGACTGGCTGCATTCAAACTGTCAGGGCTGAAAG
AAATACCGGTGCAGTGGGCTACGGAGAAAGAAATTGCTGGCCAAATGTGGAAAATGACTACGAAAACAGA
TGGAAAAAGTATCATTCTTAAAATGGGTGATGGTATTAAGAGAGTTATAGGTGGCTAA