SecReT6
Effector Protein ID: 386016333
-
SecReT6 ID606
T6SS typeA3
Gene symbol-
Locus tagPAJ_1743
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2108720..2109202 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA3456
DescriptionHcp protein
UniProt IDF2EXB5
KEGG IDpaj:PAJ_1743
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.80E-39, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|386016333|ref|YP_005934619.1| hypothetical protein PAJ_1743 [Pantoea ananatis AJ13355]
MAIDIFLKIDGIEGESQNANHKKWIDVLSFNWGAQQPGNMSVGGGGGAGKVNYRDLSVEALIDKATPALV
KYCASGKHLPKIQLSVCKAGGQEVEYTRITLEDVLVTQTDFTGIGHASTLGMQYSFQASKVALEYWEQAS
QGTKAASVQMGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2109202-2108720 Pantoea ananatis AJ13355, complete genome
ATGGCTATTGATATCTTTTTGAAAATAGATGGAATTGAAGGTGAGTCGCAAAATGCAAACCATAAAAAAT
GGATAGATGTTCTGTCATTTAACTGGGGCGCGCAGCAACCAGGTAATATGTCCGTTGGCGGTGGTGGCGG
TGCGGGAAAAGTGAATTATCGCGATTTAAGTGTTGAGGCATTGATCGATAAGGCCACACCGGCGTTAGTG
AAATATTGTGCCAGTGGTAAGCATCTGCCAAAAATTCAGCTGTCTGTTTGCAAGGCAGGCGGGCAGGAAG
TGGAATATACTCGCATCACGCTTGAAGATGTGCTGGTTACGCAGACTGACTTTACCGGCATTGGTCACGC
GTCCACGCTGGGTATGCAGTATTCCTTTCAAGCCAGCAAGGTTGCGCTGGAATACTGGGAACAGGCTTCT
CAGGGAACGAAAGCCGCTTCTGTGCAGATGGGTTGGGATATCAAGCAAAATAAAGAAAGCTAA