SecReT6
Effector Protein ID: 386016334
-
SecReT6 ID606
T6SS typeA3
Gene symbol-
Locus tagPAJ_1744
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2109233..2109715 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDF2EXB6
KEGG IDpaj:PAJ_1744
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-35, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|386016334|ref|YP_005934620.1| hypothetical protein PAJ_1744 [Pantoea ananatis AJ13355]
MAIDIYLKVEGTTGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNFNDLRVKALIDKSTAAIL
KYCSSGKHVSKVELSVCKAGGNQIEYTKIVLEDVLVTATDFNGVGQGDTIVVDYAFQASKVSTSYWEQSA
SGTKGAESKAGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2109715-2109233 Pantoea ananatis AJ13355, complete genome
ATGGCGATTGATATTTATTTGAAAGTTGAAGGGACTACTGGAGAATCACAGGACAGCAATCATAAAGGAT
GGACCGACGTGCTCTCATTTAACTGGGGGGCTTCGCAACCCGGTAATATGGCGGTAGGTGGCGGTGGCGG
CTCAGGAAAAGTGAATTTCAACGATCTGCGTGTTAAAGCGTTAATCGACAAATCCACTGCTGCCATTCTT
AAATACTGCTCCAGCGGAAAGCATGTTTCAAAGGTAGAACTGTCGGTTTGCAAAGCCGGTGGCAACCAAA
TTGAGTACACGAAGATTGTGCTGGAAGATGTACTGGTTACGGCAACGGATTTTAACGGAGTAGGGCAAGG
TGACACCATTGTGGTGGACTACGCCTTTCAGGCATCCAAAGTGTCTACCAGCTACTGGGAACAAAGTGCC
AGCGGTACCAAAGGGGCGGAAAGCAAAGCCGGTTGGGATATTAAACAAAATAAAGAGAGCTGA