SecReT6
Effector Protein ID: 386056164
-
SecReT6 ID611
T6SS typeA3
Gene symbol-
Locus tagPAM18_0095
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]111752..113044 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDG2KZY2
KEGG IDpaf:PAM18_0095
PDB IDNA
Domain hit(s) vs Pfam Toxin_61 [PF15538], Evalue: 3.30E-75, Aligned region: 266..422
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 78..153
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 125..146
Protein Sequence: 430 a.a.     [Download]
>gi|386056164|ref|YP_005972686.1| hypothetical protein PAM18_0095 [Pseudomonas aeruginosa M18]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNL
DHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPR
VQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
-
Nucleotide Sequence: 1293 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c113044-111752 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGTTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGGACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGCCGGCTTCGTCGCCATC
GGCGGGCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCGGGGATGGCATTGCTGGGCTTCGGGCCGAAACTCGCCGGTCGTCGTCCGGC
AGCGGTGACCTCCGAAACCGCGCAACGACGCGCCTACCTGAACAACAAGTTCGGTCGTTCCGGCAACCTC
GACCACGACATCAACTACCGCGGGAATCGTGAAACCGCCGCCAAGTTCTTCAAGTCGAAGGACATCGATC
CTGCCGATGCCGAGTCGTACATGAACGGCCTGGACTTCAACCATCCGGTCCGTGTGGAAACCCTCGCGCC
CGGCAAGAACCTGTGGCAGTACCAGTCCCCCGGAGCGCCGCAGGGCAACTGGTATACACTCAGCCCGCGC
GTGCAGCCCACGGAGCTGGGAATCAACCCCATGGGCACCAACCGGGCGGCGAACACCATCGAACCCAAGG
TCCTCAACTCCTACAGGACGACCCAGAAGGTCGAGGTCCTGCGCAGCACCGCTGCGCCGACCGATGACTT
CTGGTCGGTAAAGGGACAGTCATATCCCGCCAAAGGCGGCGCGCAACAACTGTTCTCCAACGAGAAAGGC
TCCTTCGGTCTGCTTCCCCGGGAGGGATCATGA