SecReT6
Effector Protein ID: 386056166
-
SecReT6 ID611
T6SS typeA3
Gene symbol-
Locus tagPAM18_0097
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]113748..115973 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0095
Descriptiontype VI secretion system Vgr family protein
UniProt IDG2L0V6
KEGG IDpaf:PAM18_0097
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-89, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 2.80E-89, Aligned region: 346..395
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 529..552
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 586..608
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 594..616
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 4.30E-28, Aligned region: 715..731
Phage_base_V [PF04717], Evalue: 7.80E-26, Aligned region: 369..462
Protein Sequence: 741 a.a.     [Download]
>gi|386056166|ref|YP_005972688.1| hypothetical protein PAM18_0097 [Pseudomonas aeruginosa M18]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAERNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETIS
IGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASI
RMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN
-
Nucleotide Sequence: 2226 bp     [Download]
>gi|386056071|ref|NC_017548.1|:113748-115973 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGC
AGCGAATGGAGGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCC
CGACCTGCCACTCGACGGGCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGG
CGGCATTTCCACGGCATCGTCGCCGCTTGCAGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCACCAGAGCCCGCCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGC
GACCATTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCACTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGCTCGCACGCGGCGGCCGACTACCC
GCTGTACGACTACCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGGACCCGCATCGAA
GCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCCGCGCCCGCGGCCTGGGTTCGGGCCACCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCGCAGTTCGAGAGCGAGCTGGACTGCATC
GATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCACTG
GGACCGCCACGACCAGTCCAACGAGAATAGCTCCTGCTGGATGCGCGTCTCCCAGGCCTGGGCGGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTTGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCATCGGTGTCGACCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGTATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCG
GCGTCGACCGCACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGTGCCAATCGCACCGAGGACGT
CGGCAACGACGAGACCATCAGCATCGGCGCGAACCGTAGCGAGTCGGTGGGCAACAACGAGACGATCAGC
ATCGGCGCCGACCGCAGCGAGTCGGTGGGCGCCAACGAGACCATCGACATAGGCGGCAACCAGAGCACCA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCGCGATACCTCGGTGGGCAAGGACGATAGCCT
GGACGTGGGCAAGAGCTTCACGCTCAACGCCGGCGACTCGATCACCCTGGTCACCGGTGCCGCCAGCATC
CGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGATCCGGGGCGATCA
ACGTCAAGGCCGACAAGAACGTGGTGGTGAAGGGACGCAAGATCCTCCAGAACTGA