SecReT6
Effector Protein ID: 386056170
-
SecReT6 ID611
T6SS typeA3
Gene symbol-
Locus tagPAM18_0101
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]118613..119773 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0099
DescriptionPA0099
UniProt IDG2L0W0
KEGG IDpaf:PAM18_0101
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 8.30E-38, Aligned region: 19..134
Tox-GHH2 [PF15635], Evalue: 2.20E-33, Aligned region: 226..344
Protein Sequence: 386 a.a.     [Download]
>gi|386056170|ref|YP_005972692.1| hypothetical protein PAM18_0101 [Pseudomonas aeruginosa M18]
MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVM
LKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWP
YLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTAR
RCALQPYKPNSCCPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMH
TFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINA
RTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR
-
Nucleotide Sequence: 1161 bp     [Download]
>gi|386056071|ref|NC_017548.1|:118613-119773 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAGCGGCAAGTCCATCGCGG
CCTTCCCGGATGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCC
CAATACCGGCCTGTCCAAGGACACCACCAAGGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATG
CTGAAGAACAAGAGCTACTACAAGACCAGCTACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCG
TTACCAGCAAGATCAAGGGCAAGGTGTACTTCACCTCCTGGTCGATGAACGTCAAGTTCGAAAGCAAGAA
CGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCTGGCAATACGCCGGTCTGGCCC
TACCTCGACCAGGCCACCGTCGATGCTGGTGGTGGACCGTGCAGCAATGAAGTGAAGAAGGAGAAGAAGG
ATTGCGCTGACTTCAAGCCGCATGGCAGCAAGGATGCCTGCGCTGGCCTTGGCGCGGGCAAGCCTTCCGG
CAAGAAGACCAGCAACGAAGCTGACCGACTGGCAGACAAGGTCGCTGCCCGAAAATGCCTGACCGCGCGC
CGGTGTGCCCTGCAACCGTACAAGCCGAACAGTTGCTGCCCGCAGCAGACCGCTCACCACCTGATCGAGG
CCAGCGCCTTGCACGACAAGGGACGTGGTGGAAAAGGCTCGGTACCCCTCAAGGGGATATCCAACTATTC
GGAGAACAAGGCTCCTTGCGTCTGCGCGGAGGGCGTCAATCAGAACGTGGGTACCCACGGCCTCATGCAC
ACGTTCCAGAGCGCCGCTGCCGCGAAGTCGCGCAGTGGAACCCTGCAATTGTCCAATGGCAGCTCCATCT
CCGCGAAGAAGACCACCTACGGAACGGCGAAACGTCAATCCATGGCTGCCATGGGCAAGGTCTTTCCGCA
GTCGAAATGCTCGAAGGAATGTCTGTCCGCTCAGCTCGACAACTATCACAAGCAGTGCGGAATCAACGCC
AGAACACCCATCAAGGCCGTTGAAACCGGCCAGACCGACGTCACGGCTGCGACGCAGGCGATAAAGACCC
GCAATGCGCGTCTTGGCGCCACGAGGAGTCGAGTCCGCTAG