SecReT6
Effector Protein ID: 386058333
-
SecReT6 ID611
T6SS typeA3
Gene symbol-
Locus tagPAM18_2270
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2461803..2462279 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702
DescriptionTse2
UniProt IDG2LCI9
KEGG IDpaf:PAM18_2270
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|386058333|ref|YP_005974855.1| hypothetical protein PAM18_2270 [Pseudomonas aeruginosa M18]
MSYDYEKTSLTLYRAVFKANYDGDVGRYLHPDKELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDG
LYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQL
DNFVRNAIRRQWEKARGL
-
Nucleotide Sequence: 477 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c2462279-2461803 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGTCCTACGACTACGAGAAAACCAGCCTCACCCTCTACCGGGCGGTATTCAAGGCCAACTACGACGGCG
ACGTCGGTCGCTACCTGCATCCCGACAAGGAACTCGCCGAGGCTGCGGAAGTCGCCCCGCTGCTGCATCC
GACCTTCGACAGCCCCAACACCCCTGGCGTCCCCGCCCGCGCGCCGGACATCGTCGCCGGCCGCGACGGC
CTCTACGCCCCGGACACCGGCGGCACCTCGGTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCG
ACTTCGTGATACCCGACGGCACCGACATCCCGCCGGACCTTAAGGTGAAGCAGGACAGCTACAACAAGCG
CCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGGAGGTCCTCATGGGCCAACTG
GACAACTTCGTGCGCAACGCCATCCGCCGCCAATGGGAAAAAGCCCGCGGGCTCTAG