SecReT6
Effector Protein ID: 386058350
-
SecReT6 ID611
T6SS typeA3
Gene symbol-
Locus tagPAM18_2287
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2481311..2483380 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDG2LCK6
KEGG IDpaf:PAM18_2287
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-86, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 6.70E-86, Aligned region: 347..394
Phage_base_V [PF04717], Evalue: 6.90E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 4.60E-09, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 4.60E-09, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 4.60E-09, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 4.60E-09, Aligned region: 553..575
Gp5_C [PF06715], Evalue: 4.60E-09, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 4.60E-09, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 4.50E-05, Aligned region: 645..683
Protein Sequence: 689 a.a.     [Download]
>gi|386058350|ref|YP_005974872.1| hypothetical protein PAM18_2287 [Pseudomonas aeruginosa M18]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSR
RYFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRER
DHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCI
DAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAERNQDIEVENDESHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|386056071|ref|NC_017548.1|:2481311-2483380 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGCTGTTCTCCCAACACACCCGCCTGGTACACGTGGACTCCCCGCTGGGACCCGAGGTCCTGCAACTGC
AACGGCTGGAGGGTCGCGAAGAGCTGGGCCGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCC
CGCTTTGCCTCTGGATGCCCTGTTGGGCAAGCCGATGAGCCTCGCGCTGGAACTTCCCGGCGGCAGCCGG
CGGTATTTCCACGGCATCGTCGCGCGCTGTAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGGCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTTGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGTGTGCAATACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATTTACTACTGGTTCCGCCACGAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGG
CGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTATTACCCGCCGAGCCTCGGCCACCGCGAGCGC
GACCACTTCTTCGACTGGCACATGGCGCGCGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCACCCGCCTGGAAGTGCGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCC
GCTCTACGACTACCCTGGCGAGTATGTGCAGAGTCAGGACGGCGAACACTATGCACGGACCCGCATCGAG
GCGATCCAGACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGTATTGGGGCGGGCCATCTGT
TCCACCTGAGCAACTACCCGCGCCTGGACCAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGT
AGTCCAGGAACTCTACGAGACCGGTAATGGCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATC
GACGCCGGCCAGGCTTTCCGCCCCTTGCCGTCGACCCCGGTGCCGGTGGTGCGTGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTATGGCCGGGTCAAGGTGCATTTCCACTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACG
ACGAGAGCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACGGTGCATGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGAC
CGCAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGT
CGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGATGGCTCGAAGATCACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGA
GATCGAGATCCTCTCGCCCAATGTCGATATCAACTGTTGA