SecReT6
Effector Protein ID: 386058351
-
SecReT6 ID611
T6SS typeA3
Gene symbol-
Locus tagPAM18_2288
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2483430..2487383 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2684
DescriptionTse5
UniProt IDG2LCK7
KEGG IDpaf:PAM18_2288
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 198..220
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 274..290
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 320..338
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 343..361
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 381..415
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 426..461
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 472..500
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 489..524
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 574..609
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 615..642
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 636..670
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 685..709
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 703..740
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 767..778
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 816..834
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 821..855
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 842..870
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 924..942
RHS_repeat [PF05593], Evalue: 3.50E-54, Aligned region: 948..981
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 497..516
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 1065..1104
Protein Sequence: 1317 a.a.     [Download]
>gi|386058351|ref|YP_005974873.1| hypothetical protein PAM18_2288 [Pseudomonas aeruginosa M18]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPD
TFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRR
GGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGL
LTGVRDSAGRSYALVYQQACEPSEGDDGLRLFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIA
VRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPHGRIVKQIEAGGLTRTFRYLRDATEVSDSLG
RVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYR
KRVDEETGLLVELEDAMQRRWTFERDERGNATTVRGPAGSTRYAYEDPRLPDRPTRIVDPRGGERRLEWN
RFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTR
IADAEGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGR
RQRYRYNAADELIAREDADGRETTYAYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVR
YTYDEVGNLRLESQVHADGWVYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERD
ALHREVRRDARRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRY
EYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEYAREDARQAFAENELYRSGFSRSEARANQAGEGPA
RWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRDYADGTRLEARYRYDALSRRI
AKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQLRQAFAAEGQ
PLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEES
GLYYNRYRYYLPEAGRYASQDPLGLGGGPNLYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGA
GIELGMQTGKQVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRT
LSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
-
Nucleotide Sequence: 3954 bp     [Download]
>gi|386056071|ref|NC_017548.1|:2483430-2487383 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAGCGGCCTACCGGTTTCCCATGTCGGCGAGAAAGTCTCGGGAGGGGTGATCTCCACCGGCTCGCCCA
CCGTGCACGTCGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCCGCCTGCGTGCCGTTGGTGGGCAA
GCCGGTCAACCCGATGCTCGGCAGCAAGCTGCTGCCGGAAGAGGTCGATTTCGCCCTGGCGGCGCCGGAC
ACCTTCACCTTCGCCCGTGGCTACCTGTCGAGCAACCCCCGTATCGGCCGGCTCGGCCGGGGCTGGTGGC
TGCCGGGCGAGAGCATGCACCTGGAACTGAGCGAAGACGCCTGCGTGCTGGTCGACGCCCAGGGCCGCCG
GATCGGCTTTCCTGCGCTGGCTCCCGGTGCCCAGCATTATTCCGGCAGCGAGGAGCTGTGGCTGCGCCGC
GGCGGTTCGAGCGGCGGCGAAGCGCAGGCCTGGCGCGGGCGCTGGGCGGCGGTGCCGGCCGAACTGCAGA
CGCAGGAGGGCTCCGTGCTGGTGCTGTCCGGCCACAGCTACCTGCATTTCCAGCGTTGCCCCGACGGTAT
CTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGCACCGAGTTCCGCTGGAGCGGACGTGGCCTG
CTCACCGGCGTGCGCGACAGCGCCGGGCGCAGCTATGCGCTGGTCTACCAGCAAGCCTGCGAGCCGAGCG
AGGGCGACGACGGCCTGCGTCTGTTCGGCGTGATCCTGGCCAGCCACGACGGACCGCCTCCGGACTACAT
CGATCCGCAGAGCCCGGGGCTCGACTGGCTGGTGCGCTACCAGTTCAGCGACAGCGGCGATCTGATCGCC
GTGCGCGACCGTCTTGGCCAGGTGGTCCGGGTATTCGCCTGGCGCGAGCACATGCTGGTCGCCCACGGCG
AACCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCTCCGCACGGGCGGATCGTGAAGCAGAT
CGAGGCGGGCGGCCTGACCCGTACCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGACAGCCTCGGC
CGCGTCGAACGCTACGAGTTCGCCGGCGAGGGCGGGCAGCGGCGCTGGACCGCGCTGGTCAGGGCCGACG
GCAGCCGTAGCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCATGCGCGATCCGCTGGGACGGGA
GACGCGGCGCCGGCGCGATGGCCAGGGGCGGATGCTCGAGGAGGAGTCGCCGGGCAAGGCGCGCTATCGC
AAGCGCGTCGACGAAGAGACCGGGCTGCTGGTCGAGCTGGAGGACGCGATGCAGCGCCGCTGGACCTTCG
AGCGCGACGAACGGGGCAATGCGACGACGGTGCGTGGCCCGGCCGGCAGCACCCGCTACGCCTACGAAGA
CCCGCGCCTGCCCGACCGGCCGACGCGAATCGTCGACCCGCGCGGCGGCGAGCGGCGCCTGGAGTGGAAC
CGCTTCGGCCTGTTGGCCGCGTTGACCGATTGTTCCGGCCAGGTCTGGCGTTACGACTACGACAACGAAG
GACGTTTGGTCGCCAGCAGCGACCCGCTGGGACAACTGACCCGGCGCCGCTACGACCCGCTGGGGCAACT
GATCGGCCTGGAATTGGCCGACGGCAGCGCCCTGAGCTATGAATACGACGCCCTTGGGAGGCAGACCCGT
ATCGCCGATGCCGAGGGGCACGCCACGCTGTTTTCCTGGGGGCACGGCGATCTGCTGGCGCGGGTTTCCG
ACGCCGGCGGCGGCGAATTGTCCTACCTGCACGACGAAGCCGGCAGGCTGGTCGCCCTGACCAACGAGAA
CGGCGTCCAGGCGCAGTTCCGCTACGACCTGCTGGACCGTCTGGTGGAAGAGACCGGCTTCGACGGTCGT
CGCCAACGCTATCGCTACAACGCCGCTGACGAACTGATCGCCCGCGAGGATGCCGACGGTCGCGAGACCA
CCTATGCCTACGACCGCGATGGCCGCCTGGCGAGCATCCGGGTTCCCGCCACCGAGCACGCACCGGCCCT
GGTCGAGCGTTACCGCTGGTTGGCCGACGGCCGCCTGGCCAGCGCCGGCGGGGCGGATTGCGAGGTGCGC
TACACGTACGACGAGGTCGGTAACCTGCGCCTGGAAAGCCAGGTACATGCCGACGGTTGGGTCTACAGCG
TCGAGCACAGCCACGACGCGCTAGGCGTGCGCCAGACCAGCCGCTACGGCGACGCGCCGCCGGTCGCCTG
GCTGACCTATGGCCCGGGTCATCTGCACGGCGCGCTGGTCGGTGCGGTCGAGCTGGCCTTCGAGCGCGAT
GCCCTGCACCGTGAGGTGCGTCGCGACGCCCGCCGCGACGGGCAGGATGACGCGTTGTTCACCCAGGAGC
GCCAGCACGCGCCGCTGGGACGCCTGCAGCGCAGCCGCCTGCGTCTGGCCGGCGGTTTCGACTGGCAGCG
CGGCTATCGCTACGACGGACTTGGACAACTGGTCGGCATCGACGACAACCAGTATCCGTCGGTGCGCTAC
GAATACGACCTCGGCGGTCGCCTGCTGGCCAGCCGGCGCGCTGGCGCGGCGGCCAGCACCTACCGCTACG
ACGCCGCCGGCAACCGCCTGGAGGGCGTCGGCGAGTACGCGCGCGAGGACGCTCGCCAGGCATTCGCCGA
GAACGAACTGTACCGCTCCGGTTTCAGTCGCTCCGAGGCGCGCGCGAACCAGGCCGGCGAAGGCCCGGCG
CGCTGGGCCGGCAACCGCGTGGAGAGGATCGCCGGCAACCGCTATCGCTTCGATGCGCTGGGCAACCTGG
TCGAGCGTATCGGCGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGTCCATCT
GACGCGCGATTACGCCGACGGCACGCGGCTGGAGGCGCGCTACCGCTACGACGCGCTGTCGCGACGGATC
GCCAAGGTGGTGCTGCGCGACGGTGTCGAGCAGCAGGTGCGCTTCGGCTGGGACGGCGATCGCCAATGCG
CCGAAGCCTTTGCGCGGGAACTGCGCACCACCGTTCACGAACCGGGCGGTTTCGTCCCGTTGCTGCGCCT
GGAGCAGGCCTGCGAGCCCGATCCCCCGGAGCTGCTGCAACTGCGCCAGGCGTTCGCCGCCGAAGGCCAG
CCGCTGCCGGCGCAATGCGTGCCGGCGCTGGGCGAGGCGCGGATCGCTTTCTTCCACACCGATCACCTCG
GTACCCCCCTGCAGCTGAGCGACGAACGTGGCCAACTGCGTTGGCAGGGCGTTCCGGACGACTGGCGGGC
GGTAGCGCCGGAACGACAGCCGGGTGCGCAGCCGATCCGCTTCCAGGGGCAGTACCACGATGAGGAAAGC
GGCCTCTACTACAACCGCTACCGTTACTACCTGCCGGAAGCCGGGCGCTATGCCAGCCAGGACCCGCTCG
GCCTGGGCGGTGGCCCCAACCTCTATGCCTATGCGCTGAACGCGCCCACGCTGGCCTACGATCCCACCGG
CCTGATCATCCCGCTGGTGGTGATCGGCGCCTTCGCCGCCCGCGCCGCGATCGGAGCGGCGCTGGGCGCC
GGCATCGAGCTGGGGATGCAGACCGGCAAGCAGGTGCTGGGGCAGATGAAGGACAACTGGGACAGCGATC
GCGACCTCACCGATATCAAGTGGAAGTGCATCGACATCAACTGGAAACACGTCGGCGCCTCGGCGGCCAT
CGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACCGTGGTGCAGTCCGCCAAGGCGATCAGGACC
CTTTCCGGACAGGCGGCCAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCCGCCCATGCCG
ATACCATCAAGAAGGCCGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAATGCCCGCT
GAAGGACGAAGAAGAGGAGTGCCCGCCGCAATGA