SecReT6
Effector Protein ID: 386061444
hcpB
SecReT6 ID613
T6SS typeA1
Gene symbolhcpB
Locus tagPAM18_5387
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]5987719..5988237 [-]
Productsecreted protein Hcp
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDG2L443
KEGG IDpaf:PAM18_5387, paf:PAM18_0258, paf:PAM18_3619
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|386061444|ref|YP_005977966.1| secreted protein Hcp [Pseudomonas aeruginosa M18]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c5988237-5987719 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGATTCGGTCGGCAACACCTACCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGCGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCCCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
TGGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCAC
CTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCG
ACGACTGGCGCTCCCCGGTCGCCGGCTGA