SecReT6
Effector Protein ID: 386063392
-
SecReT6 ID616
T6SS typeA4a
Gene symbol-
Locus tagNCGM2_0421
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]466750..468987 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDG4LEY1
KEGG IDpnc:NCGM2_0421
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.10E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.10E-06, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 1.70E-06, Aligned region: 56..116
PLDc_2 [PF13091], Evalue: 1.70E-06, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 1.70E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 1.70E-06, Aligned region: 635..687
Protein Sequence: 745 a.a.     [Download]
>gi|386063392|ref|YP_005978696.1| hypothetical protein NCGM2_0421 [Pseudomonas aeruginosa NCGM2.S1]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARARIAELEAENAENQRTFDSSE
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDGERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEQKGVT
PEVEQRLGGLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGIAQPNPDLARAMREELWGAHVGRLAETT
EKNFELWNQKMDDNWKAQVADEPFTSHLLRFWDVTTPYSQNLTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|386062973|ref|NC_017549.1|:466750-468987 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTGTACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCCTTCTACCCACCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCCATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGCTTCAAGCGCCCCGACGGACCGCGAATAGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGGGTGCAGGCGCGGGTGCTGGTCTGGAGCAACCAGCTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCAGTG
GACAACGAGGTGCTGCGGCTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAGCGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGGCGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGAACCAGCGCACTTTCGACAGCAGCGAG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAGGTGCGCCTCGTCAACGGGCGACTGCAAAGCCTGATCCAC
CTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGACCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGAACCCAGCCA
CAGGACGGCGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAAGCGCTCGAACAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGGACTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTTGCCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCTGCCCCCGGCAGCCCGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCGCCG
CCGCTGAAGGCGCGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGATGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGGGCGCATGTTGGGAGGTTGGCCGAAACGACC
GAAAAAAACTTCGAATTGTGGAATCAGAAGATGGATGATAACTGGAAGGCCCAGGTGGCAGATGAGCCTT
TTACTTCGCACTTGCTGCGCTTCTGGGATGTCACTACACCCTATAGTCAAAATCTTACGGTGGACTGA