SecReT6
Effector Protein ID: 386065489
-
SecReT6 ID615
T6SS typeA1
Gene symbol-
Locus tagNCGM2_2550
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2728078..2731440 [-]
Productputative Rhs family protein
Effector typeProtein
Homologous effectorPA14_43100
DescriptionRhsP2
UniProt IDG4LBC1
KEGG IDpnc:NCGM2_2550
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 562..582
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 632..656
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 698..733
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 739..768
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 801..834
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 842..878
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 884..920
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 929..957
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 970..1001
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 1017..1049
RHS_repeat [PF05593], Evalue: 1.40E-45, Aligned region: 1037..1065
Protein Sequence: 1120 a.a.     [Download]
>gi|386065489|ref|YP_005980793.1| putative Rhs family protein [Pseudomonas aeruginosa NCGM2.S1]
MISSFYAMFMLRGVNAKQPDASQLIGEFSSGVLNRYEEYANSWLWGWALDVQQTIALSDGNGNELTRLKA
DKDANILEDVASCPVNGQLKLLHTFESTSFVPIGNTPYEITRIGSRTPQFKGVLDADGMASISGCAPNTL
YQVKFYPEVSIQEIDALYRSYDDVIAKLNEWLLEQWNGPLSAEWKRLAPVGDRRRMEQITDAYLDGMGKA
LVNLWDDVVELFGILANLDEHAAKLLEFINEADFEKLKAQAKELLGTALLIASDEPLLFIYASAIVCWTQ
LLPPTTAAEMVAELSTGLLLDILLGIILTGGAGLAVRLAVKGSKAIKASEGAMLLRKAMQVLIDTSCRHS
LQLHAEKLKPLAVRGEVMANSSNKITAQIQSTAQGIARTEPDTLPLSRGKRANTSLSSSQATPDASAPGR
TPAGKPADQAAQTCVKDCPVSMVTGEELLTLTDCELDGPLRFAWTRLYRTSAAEIDNGLGFGWSHALSHR
LDRDGDELVWTDHENRRTRFPIPDAQRPAITNRLSRAAIYLGGDPSELILAQAGEKPRFYHFRKDPDGAY
LIAISDAYGNRLELSRDRLGRPRRLSHKAGRALLLCYQGRHIERVEYQVYQPADNLEACWHTTQVLARYR
CNERGQLIEAGNALYEAERYRYDARNVILERQLAGGASFFWEWEGEGKQARAVHHWASFPQMDSRYVWNE
DGSVTAINADGSEEVYVHDDNARLVRQVDPDGGETLRHYDEKGQLVAERDPLGTITEYRYDQAGRLEALL
PAEGEPTCYSYFDGFVRSVRRGEAQWKYERNAQGDITRQTDPEGNVTHYAYDHRGCLVEITHADDSLHQL
TWNPLGQLIEEQLPDGSVRRYRYDTLGRQITRQDESGAITRFQWDAAGRLSQITLPGGASRMYRYNAYGK
VTSECDEQGRMTRYEYLDDLHLVSRRINPDGSQLRYRYENARLLLSEIENERGERYRLDYHGNGLISQET
GFDGRRTAYRYDLKGQLLEKTEYGDDGSELRTTYQRDSTGRLLAKTLPDGNRVDYRYDTLGRLVAVDDGT
WPLAYEYDLRDRLVPRAPGLGHPSLRLRRPRPVDPLPTARRQPRRLPLPDRRHPLGNRSQRPVPDPAPVR
-
Nucleotide Sequence: 3363 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c2731440-2728078 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGATCTCGTCGTTCTACGCCATGTTCATGCTGCGCGGAGTGAACGCGAAGCAGCCGGATGCCAGCCAGT
TGATCGGCGAATTCAGCTCCGGGGTGCTCAACCGCTATGAGGAATATGCGAACAGTTGGCTCTGGGGCTG
GGCACTCGACGTCCAGCAGACCATCGCCCTTTCCGATGGGAACGGCAACGAGTTGACCAGGCTGAAAGCC
GACAAGGACGCCAACATCCTCGAAGACGTCGCCTCATGTCCGGTCAACGGTCAACTGAAACTGCTGCATA
CTTTCGAATCGACCAGTTTCGTGCCCATCGGCAACACGCCTTACGAAATCACTCGGATAGGCAGCAGGAC
ACCGCAGTTCAAGGGCGTACTGGATGCAGATGGGATGGCGAGCATAAGCGGCTGCGCTCCCAATACGCTG
TACCAGGTCAAGTTCTACCCAGAGGTAAGCATCCAGGAGATCGACGCGCTCTACCGCTCCTACGACGACG
TAATCGCCAAGCTGAACGAATGGCTTCTGGAGCAATGGAACGGCCCGCTTTCCGCCGAATGGAAAAGGCT
CGCGCCGGTTGGCGACCGTAGGCGGATGGAGCAGATAACCGACGCCTATCTGGACGGCATGGGCAAAGCG
CTGGTCAATCTCTGGGATGATGTGGTCGAGCTGTTCGGCATCCTCGCGAACCTCGACGAGCACGCGGCGA
AACTCCTTGAGTTCATCAACGAAGCGGATTTCGAAAAGCTCAAGGCTCAGGCCAAGGAACTCCTCGGTAC
CGCCTTGCTGATCGCCAGCGACGAACCGCTTCTGTTCATCTATGCCAGCGCCATCGTGTGCTGGACCCAG
TTGCTGCCGCCCACGACTGCCGCGGAAATGGTCGCGGAACTCTCCACCGGCCTGCTCCTCGATATTCTGC
TCGGCATCATCCTGACCGGCGGAGCCGGTCTCGCCGTTCGCCTGGCCGTCAAGGGCTCGAAAGCGATCAA
GGCCTCCGAAGGTGCGATGCTGCTGCGCAAAGCCATGCAGGTGCTGATCGATACCAGCTGTCGGCATTCC
CTCCAGTTGCACGCGGAAAAGCTGAAACCTCTGGCCGTCCGCGGTGAAGTGATGGCCAACAGCTCCAACA
AGATCACCGCACAGATCCAGAGCACCGCCCAAGGCATCGCCCGCACCGAGCCCGACACCCTGCCGCTGAG
CCGAGGAAAGCGCGCGAACACCTCGCTCTCCAGCAGTCAGGCGACGCCCGATGCCTCCGCACCCGGCAGG
ACGCCCGCCGGCAAACCCGCCGACCAGGCCGCCCAGACCTGCGTCAAGGACTGTCCCGTTTCGATGGTCA
CCGGCGAGGAGCTGCTGACCCTGACCGACTGCGAGCTGGACGGTCCGCTGCGTTTCGCCTGGACGCGCCT
GTACCGCACCAGCGCGGCGGAAATCGACAATGGTCTGGGCTTCGGCTGGAGCCATGCACTCTCCCATCGC
CTCGATCGCGACGGCGACGAGCTGGTATGGACCGATCACGAGAACCGCCGGACCCGCTTCCCGATCCCTG
ACGCCCAGCGCCCGGCGATCACCAACCGACTGTCGCGCGCCGCCATCTACCTCGGCGGCGACCCATCCGA
ACTGATCCTTGCCCAGGCCGGCGAAAAGCCGCGCTTCTACCACTTCCGCAAAGACCCGGACGGCGCTTAC
CTGATCGCCATCAGCGACGCCTACGGCAACCGCCTGGAACTGAGTCGCGACCGCCTCGGCCGGCCGCGCC
GCCTCAGCCACAAGGCCGGGCGCGCGCTACTGCTGTGCTACCAGGGCAGGCACATCGAGCGCGTCGAGTA
CCAGGTGTACCAGCCCGCCGATAACCTGGAGGCCTGCTGGCACACCACCCAGGTACTCGCCCGCTACCGC
TGCAACGAACGTGGCCAGTTGATCGAAGCCGGAAACGCACTCTACGAGGCCGAACGCTATCGCTACGACG
CGCGCAATGTCATCCTCGAGCGCCAGTTGGCCGGCGGCGCCTCGTTCTTCTGGGAATGGGAAGGCGAAGG
CAAGCAGGCCCGCGCGGTCCATCACTGGGCCAGCTTCCCGCAGATGGACTCGCGCTACGTCTGGAACGAA
GACGGCAGCGTTACCGCGATCAACGCCGACGGCAGCGAGGAAGTCTATGTCCACGACGACAACGCGCGCC
TGGTACGCCAGGTCGATCCCGACGGAGGCGAAACCCTCAGGCACTACGACGAGAAGGGCCAACTGGTCGC
CGAACGCGATCCGTTGGGAACGATCACCGAGTACCGCTACGACCAGGCCGGACGCTTGGAGGCACTGCTC
CCGGCCGAAGGCGAGCCAACCTGCTATAGCTACTTCGACGGCTTCGTGCGCAGCGTGCGCCGCGGCGAGG
CGCAGTGGAAGTACGAGCGCAACGCTCAGGGCGACATCACCCGCCAGACCGATCCCGAAGGCAACGTCAC
CCACTACGCCTACGACCACCGCGGCTGCCTGGTGGAAATCACCCATGCCGACGACAGCCTGCACCAGTTG
ACCTGGAATCCGCTCGGCCAGTTGATAGAAGAACAGCTTCCGGACGGTAGCGTGCGCCGCTATCGCTACG
ACACACTGGGTAGACAGATCACCCGCCAGGACGAAAGCGGCGCCATCACCCGGTTCCAGTGGGATGCAGC
AGGCCGCCTGAGCCAGATCACCCTGCCCGGTGGCGCCAGCCGCATGTACCGCTACAACGCTTACGGCAAG
GTCACCAGCGAGTGCGACGAACAGGGCCGGATGACCCGCTACGAATATCTTGACGACCTGCACCTGGTCA
GCCGGCGGATCAACCCGGACGGCAGTCAGCTGCGCTACCGCTACGAAAACGCCCGGCTACTGCTCAGCGA
GATCGAGAACGAACGCGGCGAACGCTATCGCCTCGATTACCACGGCAACGGCCTGATCAGCCAGGAAACC
GGCTTCGACGGCCGCCGCACCGCCTATCGCTACGACCTCAAAGGCCAGCTTCTGGAGAAAACCGAGTACG
GCGACGACGGCAGCGAACTGCGCACCACCTACCAGCGCGACAGTACCGGGCGCCTGCTGGCGAAGACACT
GCCCGACGGCAATCGGGTCGACTACCGCTACGATACGCTCGGACGCCTGGTCGCCGTCGACGACGGCACC
TGGCCGCTGGCCTACGAATACGACCTACGGGACCGCCTGGTCCCGCGAGCACCAGGGCTGGGCCACCCTT
CACTACGCCTACGACGCCCTCGGCCAGTTGATCCACTGCCGACTGCCCGACGGCAACCGCGTCGACTACC
GCTACCAGACCGGCGGCACCCTCTCGGCAATCGATCTCAACGGCCAGTCCCTGACCCGGCACCAGTTCGG
TAG