SecReT6
Effector Protein ID: 386065492
SecReT6 ID615
T6SS typeA1
Gene symbolhcpD
Locus tagNCGM2_2553
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2734406..2734924 [-]
Productsecreted protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDG4LBC4
KEGG IDpnc:NCGM2_0270, pnc:NCGM2_6030, pnc:NCGM2_2553, pnc:NCGM2_2397
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|386065492|ref|YP_005980796.1| secreted protein [Pseudomonas aeruginosa NCGM2.S1]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c2734924-2734406 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGATTCGGTCGGCAACACCTACCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGCGATCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
TCGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCAC
CTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCG
ACGACTGGCGCTCCCCGGTCGCCGGCTGA