SecReT6
Effector Protein ID: 386066636
rhs
SecReT6 ID614
T6SS typeA3
Gene symbolrhs
Locus tagNCGM2_3711
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]4048405..4052358 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2684
DescriptionTse5
UniProt IDG4LKZ8
KEGG IDpnc:NCGM2_3711
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 198..220
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 274..290
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 320..338
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 343..361
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 381..415
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 426..461
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 472..500
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 489..524
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 574..609
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 615..642
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 636..670
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 685..709
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 703..740
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 767..778
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 816..834
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 821..855
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 842..870
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 924..942
RHS_repeat [PF05593], Evalue: 5.70E-56, Aligned region: 948..981
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 497..516
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 1065..1104
Protein Sequence: 1317 a.a.     [Download]
>gi|386066636|ref|YP_005981940.1| hypothetical protein NCGM2_3711 [Pseudomonas aeruginosa NCGM2.S1]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPD
TFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRR
GGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGL
LTGVRDSAGRSYALVYQQACEPSEGDDGLRLFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIA
VRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPHGRVVKQIEAGGLTRTFRYLRDATEVSDSLG
RVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYR
KRVDEETGLLVELEDAMQRRWTFERDERGNVTTVRGPAGSTRYAYEDPRLPDRPTRIVDPRGGERRLEWN
RFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTR
IADAEGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGR
RQRYRYNAADELIAREDADGRETTYAYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVR
YTYDEVGNLRLESQVHADGWVYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERD
ALHREVRRDARRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRY
EYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEYAREDARQAFAENELYRSGFSRSEARASQAGEGPA
RWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRDYADGTRLEARYRYDALSRRI
AKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQLRQAFAAEGQ
PLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEES
GLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGA
GIELGMQTGKQVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRT
LSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
-
Nucleotide Sequence: 3954 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c4052358-4048405 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGAGCGGCCTACCGGTTTCCCATGTCGGCGAGAAAGTCTCGGGAGGGGTGATCTCCACCGGCTCGCCCA
CCGTGCACGTCGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCCGCCTGCGTGCCGTTGGTGGGCAA
GCCGGTCAACCCGATGCTCGGCAGCAAGCTGCTGCCGGAAGAGGTCGATTTCGCCCTGGCGGCGCCGGAC
ACCTTCACCTTCGCCCGTGGCTACCTGTCGAGCAACCCCCGTATCGGCCGGCTCGGCCGGGGCTGGTGGC
TGCCGGGCGAGAGCATGCACCTGGAATTGAGCGAAGACGCCTGCGTGCTGGTCGACGCCCAGGGCCGCCG
GATCGGCTTTCCTGCGCTGGCTCCCGGCGCGCAGCATTATTCCGGCAGCGAGGAGCTGTGGCTGCGCCGC
GGCGGTTCGAGCGGCGGCGAAGCGCAGGCCTGGCGCGGGCGCTGGGCGGCGGTGCCGGCCGAACTGCAGA
CGCAGGAGGGCTCCGTGCTGGTGCTGTCCGGCCACAGCTACCTGCATTTCCAGCGTTGCCCCGACGGTAT
CTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGCACCGAGTTCCGCTGGAGCGGACGTGGCCTG
CTCACCGGCGTGCGCGACAGCGCCGGGCGCAGCTATGCGTTGGTCTACCAGCAGGCCTGCGAGCCGAGCG
AGGGCGACGACGGCCTGCGTCTGTTCGGCGTGATCCTGGCCAGCCACGACGGACCGCCTCCGGACTACAT
CGATCCGCAGAGCCCGGGGCTCGACTGGCTGGTGCGCTACCAGTTCAGCGACAGCGGCGACCTGATCGCC
GTGCGCGACCGCCTCGGCCAGGTGGTCCGGGTATTCGCCTGGCGCGAGCACATGCTGGTCGCCCACGGCG
AACCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCTCCGCACGGGCGGGTCGTGAAGCAGAT
CGAGGCGGGCGGCCTGACCCGTACCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGACAGCCTCGGC
CGCGTCGAACGCTACGAGTTCGCCGGCGAGGGTGGGCAGCGGCGCTGGACCGCGCTGGTCAGGGCCGACG
GCAGCCGTAGCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCATGCGCGACCCGCTGGGGCGGGA
GACGCGGCGCCGGCGCGATGGCCAGGGGCGGATGCTCGAGGAGGAGTCGCCGGGCAAGGCGCGCTATCGC
AAGCGCGTCGACGAAGAGACCGGGCTGCTGGTCGAGCTGGAGGACGCGATGCAGCGCCGCTGGACCTTCG
AGCGCGACGAACGGGGCAATGTGACGACGGTGCGCGGCCCGGCCGGCAGCACCCGCTACGCCTACGAAGA
CCCGCGCCTGCCCGACCGGCCGACGCGAATCGTCGACCCGCGCGGCGGCGAGCGGCGCCTGGAGTGGAAC
CGCTTCGGCCTGTTGGCCGCGTTGACCGATTGTTCCGGCCAGGTCTGGCGTTACGACTACGACAACGAAG
GACGTTTGGTCGCCAGCAGCGACCCGCTGGGACAACTGACCCGGCGCCGCTACGACCCGCTGGGGCAACT
GATCGGCCTGGAATTGGCCGACGGCAGCGCCCTGAGCTATGAATACGACGCCCTTGGGCGGCAGACCCGT
ATCGCCGATGCCGAAGGGCACGCCACGCTGTTTTCCTGGGGGCACGGCGATCTGCTGGCGCGGGTTTCCG
ACGCCGGCGGCGGCGAATTGTCCTACCTGCACGACGAAGCCGGCAGGCTGGTCGCCCTGACCAACGAGAA
CGGCGTCCAGGCGCAGTTCCGCTACGACCTGCTGGACCGTCTGGTGGAAGAGACCGGCTTCGACGGTCGT
CGCCAACGCTATCGCTACAACGCCGCTGACGAACTGATCGCCCGCGAGGATGCCGACGGTCGCGAGACCA
CCTATGCCTACGACCGCGACGGCCGCCTGGCGAGCATCCGGGTTCCCGCCACCGAGCACGCACCGGCCCT
GGTCGAGCGTTACCGCTGGTTGGCCGACGGCCGCCTGGCCAGCGCCGGCGGGGCGGATTGCGAGGTGCGC
TACACGTACGACGAGGTCGGTAACCTGCGCCTGGAAAGCCAGGTACATGCCGACGGTTGGGTCTACAGCG
TCGAGCACAGCCACGACGCGCTAGGCGTGCGCCAGACCAGCCGCTACGGCGACGCGCCGCCGGTCGCCTG
GCTGACCTATGGCCCGGGTCATCTGCACGGCGCGCTGGTCGGTGCGGTCGAGCTGGCCTTCGAGCGCGAT
GCCCTGCACCGTGAGGTGCGTCGCGACGCCCGCCGCGACGGGCAGGATGACGCGTTGTTCACCCAGGAGC
GCCAGCACGCGCCGCTGGGACGCCTGCAGCGCAGCCGCCTGCGTCTGGCCGGCGGTTTCGACTGGCAGCG
CGGCTATCGCTACGACGGACTTGGACAACTGGTCGGCATCGACGACAACCAGTATCCGTCGGTGCGCTAC
GAATACGACCTCGGCGGTCGCCTGCTGGCCAGCCGGCGCGCTGGCGCGGCGGCCAGCACCTACCGCTACG
ACGCCGCCGGCAACCGCCTGGAGGGCGTCGGCGAGTACGCGCGCGAGGACGCTCGCCAGGCATTCGCCGA
GAACGAACTGTACCGCTCCGGTTTCAGTCGCTCCGAGGCGCGCGCGAGCCAGGCCGGCGAAGGCCCGGCG
CGCTGGGCCGGCAACCGCGTGGAGAGGATCGCCGGCAACCGCTATCGCTTCGATGCGCTGGGCAACCTGG
TCGAGCGTATCGGCGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGTCCATCT
GACGCGCGATTACGCCGACGGCACGCGGCTGGAGGCGCGCTACCGCTACGACGCGCTGTCGCGACGGATC
GCCAAGGTGGTGCTGCGCGACGGTGTCGAGCAGCAGGTGCGCTTCGGTTGGGACGGCGATCGCCAATGCG
CCGAAGCCTTTGCGCGGGAACTGCGCACCACCGTTCACGAACCGGGCGGTTTCGTCCCGTTGCTGCGCCT
GGAGCAGGCCTGTGAGCCCGATCCCCCGGAGCTGCTGCAACTGCGCCAGGCGTTCGCCGCCGAGGGCCAG
CCGCTGCCGGCGCAATGCGTGCCGGCGCTGGGCGAGGCGCGGATCGCTTTCTTCCACACCGACCACCTCG
GTACCCCCCTGCAGCTGAGCGACGAACGTGGCCAACTGCGTTGGCAGGGCGTTCCGGACGACTGGCGGGC
GGTAGCGCCGGAACGACAGCCGGGTGCGCAGCCGATCCGCTTCCAGGGGCAGTACCACGATGAGGAAAGC
GGCCTCTACTACAACCGCTACCGTTACTACCTGCCGGAAGCCGGGCGCTATGCCAGCCAGGACCCGCTCG
GCCTGGGCGGTGGCCCCAACCCCTATGCCTACGCGCTGAACGCGCCCACGCTGGCCTACGATCCCACCGG
CCTGATCATCCCGCTGGTGGTGATCGGCGCCTTCGCCGCCCGCGCCGCGATCGGAGCGGCGCTGGGCGCC
GGCATCGAGCTGGGGATGCAGACCGGCAAGCAGGTGCTGGGGCAGATGAAGGACAACTGGGACAGCGATC
GCGACCTCACCGATATCAAGTGGAAGTGCATCGACATCAACTGGAAACACGTCGGCGCCTCGGCGGCCAT
CGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACCGTGGTGCAGTCCGCCAAGGCGATCAGGACC
CTTTCCGGACAGGCGGCCAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCCGCCCATGCCG
ATACCATCAAGAAGGCCGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAATGCCCGCT
GAAGGACGAAGAAGAGGAGTGCCCGCCGCAATGA