SecReT6
Effector Protein ID: 386066637
-
SecReT6 ID614
T6SS typeA3
Gene symbol-
Locus tagNCGM2_3712
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]4052408..4054477 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDG4LKZ9
KEGG IDpnc:NCGM2_3712
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-85, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 1.20E-85, Aligned region: 347..394
Phage_base_V [PF04717], Evalue: 6.90E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 553..575
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 9.40E-09, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 4.40E-05, Aligned region: 645..683
Protein Sequence: 689 a.a.     [Download]
>gi|386066637|ref|YP_005981941.1| hypothetical protein NCGM2_3712 [Pseudomonas aeruginosa NCGM2.S1]
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSR
RHFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRER
DHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCI
DAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAERNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c4054477-4052408 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGCTGTTCTCCCAACACACCCGCCTGGTACACGTGGACTCCCCGCTGGGCCCCGAGGTCCTGCAACTGC
AACGGCTGGAGGGTCGCGAAGAGCTGGGCCGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCC
CGCCTTGCCTCTGGATGCCCTATTGGGCAAGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGCAGCCGG
CGGCACTTCCACGGCATCGTCGCGCGCTGTAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACTTCGGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGAGAGTGGGAATACTGTGTGCAATACCGCGAGACCAGCTTCGATTTCGTCAGCCGGTTGATGGAAC
AGGAAGGCATCTACTACTGGTTCCGCCACGAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGG
CGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTATTACCCGCCGAGCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCACATGGCGCGCGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCACCCGCCTGGAAGTGCGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCC
GCTCTACGACTACCCTGGCGAGTATGTGCAGAGCCAGGACGGCGAACACTATGCACGGACCCGCATCGAG
GCGATCCAGACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGT
TCCACCTGAGCAACTACCCGCGCCTGGACCAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGT
AGTCCAGGAACTCTACGAGACCGGTAATGGCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATC
GACGCCGGCCAGGCTTTCCGCCCCTTGCCGTCGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCATTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACTATCGACCACGACGAGACGGTGCATGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGAC
CGCAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGT
CGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGATGGCTCGAAGATCACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGA
GATCGAGATCCTCTCGCCCAATGTCGATATCAACTGTTGA