SecReT6
Effector Protein ID: 386066745
-
SecReT6 ID614
T6SS typeA3
Gene symbol-
Locus tagNCGM2_3822
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]4166027..4166614 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2774
DescriptionTse4
UniProt IDG4LM80
KEGG IDpnc:NCGM2_3822
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 195 a.a.     [Download]
>gi|386066745|ref|YP_005982049.1| hypothetical protein NCGM2_3822 [Pseudomonas aeruginosa NCGM2.S1]
MSQLPIPLPLNESRWRYVTASGGGVTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKV
NLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELGAGVIAGGSGTAILFGLDPKL
LAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVGAQFGGGAAAYLGALF
-
Nucleotide Sequence: 588 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c4166614-4166027 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGTCGCAACTTCCCATTCCCTTGCCCCTCAACGAGAGTCGCTGGCGCTATGTGACGGCCAGCGGCGGAG
GTGTGACCGTGGCCTTCCTGGCGGGCAGCGGCGGCTCCATCACGTTGCTCTCGCCGGAGGGTGAGAACGT
GTCCTTCCGCTATGGCGGGGTGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGGTC
AACCTCAATGTCAAGGGCAAGAGCGTTGGCGGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAACCG
TCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCGCGGCGACTTCACCGGGCCCTGCATGTACGT
CGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATCCTCTTCGGCCTCGATCCCAAGCTG
CTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATGTCGCGGCAAT
TGCTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGCGC
GGCGGCTTACCTGGGGGCGTTGTTCTGA