SecReT6
Effector Protein ID: 386067533
pldA
SecReT6 ID615
T6SS typeA1
Gene symbolpldA
Locus tagNCGM2_4629
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]4983314..4986613 [+]
Productphospholipase D
Effector typeProtein
Homologous effectorPA3487
DescriptionPldA
UniProt IDG4LRU3, G4LRU3
KEGG IDpnc:NCGM2_4629
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.90E-17, Aligned region: 164..189
PLDc [PF00614], Evalue: 1.90E-17, Aligned region: 852..877
PLDc_2 [PF13091], Evalue: 5.70E-09, Aligned region: 155..183
PLDc_2 [PF13091], Evalue: 5.70E-09, Aligned region: 808..894
Protein Sequence: 1099 a.a.     [Download]
>gi|386067533|ref|YP_005982837.1| phospholipase D [Pseudomonas aeruginosa NCGM2.S1]
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDYFSDLASALDS
ASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSGSLGTYDFETMLAVFQLNAGL
EGGARAFCTPAIQQSDMQGLGVAFSHHQKSVVIDNRIGYVGGIDLAYGRRDDNDFSLDASGRRGNDAYNP
GLPHLGWMAEDEHVSSMGLMMATLFDLSRPLASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALN
GAAYLSDLFRSPMLPSLQWLGRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPIEPEL
ERRLRAWLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELAGSLF
WTLHRLLQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDLARNFIDRWNG
QQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLELDPPTPCWINAPEQLPQEPE
VRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVSTEGVQSNCKDAMLLAISGAQQFIYIENQFF
QSEFGKEGEVFKDLPLSGPMASLRDVGSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQF
LKSMLAMWGVNAQGWLTHKLGEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMH
QVHLTQQSLVFGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLNLRTW
AVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPLTVRLDGKNDAIVGK
AIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLAKENTRAYERTFNFIPQNISQ
TQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAGGQLMEPMPYQEIFWRSSNLTSVKTFPPPNGVSGF
ITALPTSWTRGERNDSGLNLSILAHQDSRSLPTQVAMNGDSSAQGKHRT
-
Nucleotide Sequence: 3300 bp     [Download]
>gi|386062973|ref|NC_017549.1|:4983314-4986613 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGTTGCAGAAGAAGCCCTACAACGGCCTCCACGAAAAGGAACTCAACCAGATCAACCAGCAGGATGGCA
GCCCCTGCGTAGCCATTTCCGCACCGGGCTGTTTCATCAAGGGGTCCAACCTCTTTTCCGAAAAGCGGGC
CGGTAACCGGGTCCGCTTCTTCACCACCGGCCGGGACTACTTCAGCGACCTGGCCAGCGCCCTCGACAGC
GCCAGTTCGAGCATCTTCATCACCGGCTGGCAGGTCAACTACGACGTCCTCCTCGACGGCCGCCGCAGCC
TCTGGCAGTGCCTGCGCCAGGCGCTGGAGCGCTCGCCCGCGCTGAAGGTCTACGTGATGCCCTGGCTCAG
CCCTTCCGGCAGCCTCGGCACCTATGACTTCGAAACCATGCTCGCGGTGTTCCAGCTCAACGCCGGACTC
GAGGGCGGCGCGCGCGCCTTCTGTACGCCGGCGATCCAGCAGAGCGACATGCAGGGACTGGGCGTCGCCT
TCTCCCACCACCAGAAATCCGTGGTGATCGACAACCGCATCGGCTATGTCGGCGGGATCGACCTTGCCTA
TGGCCGTCGCGACGACAACGATTTCAGCCTCGACGCCTCCGGGCGCCGGGGCAACGACGCCTATAATCCC
GGCCTACCGCATCTTGGCTGGATGGCGGAGGACGAACACGTCAGCTCCATGGGCCTGATGATGGCCACCC
TGTTCGACCTTTCCAGGCCGCTCGCCAGCCTGACGCTGCATGCGCCCACCCTTCGCCTGTCGCCCTTCCC
GCACATCGCCGCCAGCGACGAACCGCTGCTGAGCATTCCCCTCGCACCCAGCCGCGCCCGCGCCCTCAAC
GGCGCCGCCTACCTTTCCGACCTGTTCCGCAGCCCGATGCTGCCCTCCCTGCAATGGCTCGGCCGCGCCT
ACAACAGCTCGAAAGAAGGCCTGGACGAAGGCTTCGAACGGCTCGATGCGCTCAGGCGGCAGATGGTCGC
CAGCAGCATCCGCGCCATTGCCAACCTGATCGCCGACAACCTCGACGCCCTGCCCATCGAGCCTGAACTC
GAACGCCGCCTGCGCGCCTGGCTGGAGGAACTGCGCACGGCCGCGCTCAACCTGCCGGAAGCCCTGCGGA
TCAAGAGCCTGCTCCTGATCAACCAGTGGATGAGCGAAACCGAACTGGGCCAGGTCCTGACCCTGATCAG
CGGCAAGGGCTTCGAAGATATCCCGCAGAACCTGAGCGGCAAGGCCGGCGAGTTGGCCGGCTCGCTGTTC
TGGACACTCCACAGGCTGTTGCAGGCTCGCGCCGGAGGCCACCAGCAACCCTATCGCTACCTGGACGAAG
CGCCTCAGCCATTGGCCTCGCCGGACAACGCCCGGCTGGCCGCCGACCAGCCGCGCATGCCCTGGCAGGA
TGTGCATTGCCGCATCGAAGGGCCGTCGGTGTACGACCTGGCGCGCAACTTCATCGACCGCTGGAACGGC
CAGCAGGCCTACCTGGCCAAGACGCCGGCGCTACAGGATACGGCGCTGGTACGCAGCGCCCTGGAAGCCG
TGATGAAGTGGCTGAACAGCCTGGCCGCCGCCGCGGGATTGGAGAACTACCTGGACGAGAAGCGCAACCT
CCGGCTCGAACTGGACCCACCCACGCCCTGCTGGATCAACGCGCCGGAACAGTTGCCGCAAGAGCCGGAG
GTGCGCCGCGGCGGCATGACCGTACAGGTACTGCGCAGCGCCGCGGCGCGCATGCTCGAACAGGAGCAGG
CCGGCCGCCTCGGCGCGGGAGTGAACCTGCCTTTGCAGGTCGGCGTCTCCACCGAAGGAGTCCAGAGCAA
CTGCAAGGACGCCATGCTCCTGGCGATTTCCGGGGCGCAGCAGTTCATCTATATCGAGAACCAGTTCTTC
CAGAGCGAGTTCGGCAAGGAAGGCGAAGTTTTCAAGGATCTGCCCCTTTCAGGCCCCATGGCCAGTCTGC
GCGACGTTGGCAGCCTGCGACGCGACTTCGTCGTCCGGATACGCTTGGAGGAAGCCCTGGAGCAGCGCGA
CCTCTGGCTGCTGGACTGGGCCGAAGTGGAGAAGATCGCCCAGGAGCCTGGCACCGAGGCCCGCCAGTTC
CTCAAGTCGATGCTCGCCATGTGGGGCGTGAACGCCCAGGGCTGGCTCACCCACAAGCTCGGCGAGGCCC
AGCACGGCCTGCTCAACGAGATCGGCGAAGCCCTGGCGCGGCGCATCGAACGGGCCATCCAGCGCGAGCA
CCCGTTCCACGTCTACCTGGTCCTGCCGGTGCACCCGGAGGGCGCGCTGAACGTGCCGAACATCATGCAC
CAGGTGCACCTGACCCAGCAGAGCCTGGTGTTCGGCGAACAGAGCCTGGTCAAGCGCATTCAGCGGCAGA
TGGCGCTCAAGGCCCTGGAAGGCAAGTCCGACCCGGCCCAGGCCCGGGAAATCATCGAGCGCAAGGACGC
TCGCGGTCGCCCGGTCTACGAACAGCAGGACTGGAGCCGCTACCTGACCCTGCTCAACCTGCGCACCTGG
GCGGTGCTCGGCGGGCGGGTGGTCACCGAACAGATCTACGTGCACAGCAAGCTGCTGATCGCCGACGACC
GGGTGGCCATCCTCGGCAGCGCCAATATCAACGACCGCAGCCTGCAAGGCGAGCGCGACTCCGAGCTGGC
GGTGATGGTGCGCGACAGCGAGCCGCTGACGGTCAGGCTGGACGGCAAGAACGACGCCATCGTCGGCAAG
GCCATCCACCAGTTGCGGGTGAATTTGTGGAAGAAGCATTTTGGCTTGAGCCAGGGGCCAGGCGGTTTCG
TCAAGCCGGCCAGCGAGTTGAGTGCTTATCTGTCCATCCCGGCGGCTCAAGAGGCCTGGGAAGCTATACA
AACATTAGCCAAGGAGAATACTCGTGCCTATGAACGGACTTTCAATTTTATTCCCCAAAATATCAGCCAG
ACTCAACTGCAACTGACTCCAGAGCCGCCTAAAGGATTTGAGGACGGATTTCCCGCCTCCATATGGCCAA
CCTGGGCATACAGAAAACCTGGCGAGTTAAGGGCGGGCGGACAACTGATGGAGCCGATGCCATATCAGGA
AATCTTCTGGCGCTCATCTAATCTCACTTCGGTGAAAACCTTCCCACCACCCAACGGGGTTTCCGGTTTC
ATCACGGCTCTACCAACCAGTTGGACCCGTGGTGAGCGCAATGATTCTGGCTTGAATCTAAGCATCCTGG
CACATCAGGACAGCAGATCGCTTCCCACCCAGGTCGCCATGAATGGAGATAGCTCGGCACAAGGAAAGCA
TCGCACATGA