SecReT6
Effector Protein ID: 386078803
-
SecReT6 ID617
T6SS typeA3
Gene symbol-
Locus tagPAGR_g1584
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1735948..1736430 [+]
Producthemolysin co-regulated protein Hcp1
Effector typeProtein
Homologous effectorSMA3456
DescriptionHcp protein
UniProt IDG7UBJ0
KEGG IDpaq:PAGR_g1584
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.80E-39, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|386078803|ref|YP_005992328.1| hemolysin co-regulated protein Hcp1 [Pantoea ananatis PA13]
MAIDIFLKIDGIEGESQNANHKKWIDVLSFNWGAQQPGNMSVGGGGGAGKVNYRDLSVEALIDKATPALV
KYCASGKHLPKIQLSVCKAGGQEVEYTRITLEDVLVTQTDFTGIGHASTLGMQYSFQASKVALEYWEQAS
QGTKAASVQMGWDIKQNKES
-
Nucleotide Sequence: 483 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1735948-1736430 Pantoea ananatis PA13 chromosome, complete genome
ATGGCTATTGATATCTTTTTGAAAATAGATGGAATTGAAGGTGAGTCGCAAAATGCAAACCATAAAAAAT
GGATAGATGTTCTGTCATTTAACTGGGGCGCGCAGCAACCAGGTAATATGTCCGTTGGCGGTGGTGGCGG
TGCGGGAAAAGTGAATTATCGCGATTTAAGCGTTGAGGCATTGATCGATAAGGCCACACCGGCGTTAGTG
AAATATTGTGCCAGTGGTAAACATCTGCCAAAAATTCAGCTGTCTGTTTGCAAGGCAGGCGGGCAGGAAG
TGGAATATACTCGCATCACGCTTGAAGATGTGCTGGTTACGCAGACTGACTTTACCGGCATTGGTCACGC
GTCCACGCTGGGTATGCAGTATTCCTTTCAAGCCAGCAAGGTTGCGCTGGAATACTGGGAACAGGCTTCT
CAGGGAACGAAAGCCGCTTCTGTGCAGATGGGTTGGGATATCAAGCAAAATAAAGAAAGCTAA