SecReT6
Effector Protein ID: 386078882
-
SecReT6 ID617
T6SS typeA3
Gene symbol-
Locus tagPAGR_g1664
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1829513..1829995 [+]
Producttype VI secretion system effector protein hcp
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDG7UCD6
KEGG IDpaq:PAGR_g1664
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|386078882|ref|YP_005992407.1| type VI secretion system effector protein hcp [Pantoea ananatis PA13]
MAIDMYLKVDGITGESKDSNHTGWIDITSFSWGANQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVTKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSEHDDTLGVTYAFQAAKVKQQYWEQSS
SGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1829513-1829995 Pantoea ananatis PA13 chromosome, complete genome
ATGGCTATTGATATGTATTTGAAGGTAGACGGTATTACTGGTGAATCTAAAGATTCAAACCATACCGGCT
GGATTGATATTACCTCTTTCTCCTGGGGCGCTAATCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCTGGTAAAGTAAACTTCAACGACCTGCACATTAATGCCAAAATCGACAAGGCTGTCACTGCGCTGTTG
AAAAACTGTGCCAGTGGTAAGCACGTCACTAAGGTTGAAGTTTCAGTTTGCAAGGCTGGCGGTACGCAAA
TCGAGTATACCCGCATCACCCTGGAAGACGTGCTGGTCACCAACGTACAGTTCGTGGGCTCTGAGCACGA
CGATACCCTGGGCGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGAGCTCT
TCCGGTGGCAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATCAAAGAGAATAAAGAAGCGTAA