SecReT6
Effector Protein ID: 386078907
-
SecReT6 ID617
T6SS typeA3
Gene symbol-
Locus tagPAGR_g1689
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1858385..1862773 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDG7UCG1
KEGG IDpaq:PAGR_g1689
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 392..410
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 431..444
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 482..510
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 555..576
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 590..626
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 654..690
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 697..732
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 727..745
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 759..796
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 780..816
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 801..857
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 868..896
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 914..934
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 920..955
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 983..1010
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 1050..1063
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 1055..1087
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 1093..1117
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 3.50E-56, Aligned region: 1147..1163
PAAR_motif [PF05488], Evalue: 8.30E-15, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 8.30E-15, Aligned region: 92..131
PAAR_motif [PF05488], Evalue: 8.30E-15, Aligned region: 176..218
RHS [PF03527], Evalue: 5.90E-12, Aligned region: 736..752
RHS [PF03527], Evalue: 5.90E-12, Aligned region: 762..774
RHS [PF03527], Evalue: 5.90E-12, Aligned region: 932..946
RHS [PF03527], Evalue: 5.90E-12, Aligned region: 988..1008
RHS [PF03527], Evalue: 5.90E-12, Aligned region: 1116..1127
RHS [PF03527], Evalue: 5.90E-12, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 0.0009, Aligned region: 107..125
DUF4150 [PF13665], Evalue: 0.0009, Aligned region: 170..215
Protein Sequence: 1462 a.a.     [Download]
>gi|386078907|ref|YP_005992432.1| Rhs-family protein [Pantoea ananatis PA13]
MDNRAARVGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATAAAPLLGAGMAAAGVAAIGSSCLLSGI
IGGVLANAAGISDDITKAADGLGDMIFPPSPAGVIASGSENVHVNGLLAARAAGMLTPGDTPPPEPQSPK
SFADYGGMLLSAVGQFGSAMWQPTVASADAGTSPLEQDKVACEKHSAPQYLAQGSKSVFINGQPAVRAKD
KTTCDATVSDDVSPNVIIGGETVTVREIKSGKVPGLAVMMIGLSLIRGRPSQILKNMPCALAGAVGGMMA
DMAINAAFSSLFPVHASTGVKVLNDDAERDFSLPGRFPLSFQRSYNSLTQRSGLFGLGWATVFDSYITLD
GNQATWFDDNGRELSFAVPGEKEVLYSISEGLMVRRNELGDVAIADDDGAVWRLYRRTAADPQVLRLASL
SDEYGNALEMGWDEQARLVRIHDAPLAIDVTLHYDDKQHAQRPTSASHFDGEQQWPLTHWTYNEQGQLAS
VTDAAGVVSRRFRYNDDGLMVWHQLPGGLESEYRWQKLDHWRVVENRTNTGDGCHMHYDLDAGITRVSTY
DGQQREHHWNAAGLITCFIDERGETWRYEWDENELLTRRIDPLGNAVSFTYDDLGNRVEEKDADGGVQAV
QWLSHRSLPTVVAGADGATTKYYYDPHHGLERVVDALGQSTFYKRDEFGLVVEEIDAAGNSYRREFNDAG
QVIRETDCSGLTTRYRYHPLGWLSCVTAPDGEETRYHYDAAGRPVLLERAEGWEERLRWSDNGLPLAHES
ADGKRSEFRYDNVGRLIANRNAQGETVQRSWDSRGRLTALQNENGEQYQFEWGADSLLLAQVGLDGVATR
YDYDAAGRTVSRTFAAGHPQSITHRYHWSRAGQLLARTTPEGQTRYHYSGGGQLSKVSQHLPLSDTEWSQ
QAEQEIAFTYDALGRILGEQGEQGALAWDYDALGNCTALTLPDGRNLKQLYYGSGHLLSIALDNLPVTEF
TRDTLHRELSRTQGGLTTRSEYDRLGRLRRRDVFKGEAQRPAPRVWSRRRDFDYGNNLIREERDDNPFSQ
TLWHYDNAGRLLSQEGAQPGNEQWRWDGAGNPLDRHAASHIMHNRVTELNGIRWQYDIHGRTTEKDDGQT
RWRYRYDGEHRLTDVISEPRDRNKPRTKVSFRYDPLGRRISKTRQQLLQGRPSGKAITTRFVWEGYRLLQ
EIHDDTPLTYVYSDSQSYEPLARIDGVESPEIFWFHCAANGTPELLTDVEGQKTWEGVNSPWGKLLRESN
QRIPVVEQNLRMQGQYLDRETGLHYNLFRYYDPDSGRFTQHDPIGLAGGINLYQYAPNALGWVDPLGLMK
CKNPSKEATKWQGPKNPDYPGIDVYKNRKLKKGTILYALYPNGDQQPAYVVTFPTVNQYRGDPLGYHQAL
QVKLDPRWPMRTKLRAFYVSEDIDVAYGRAAANKMYGDGGGLQFFIPEELRHLLIPGKIIDI
-
Nucleotide Sequence: 4389 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1858385-1862773 Pantoea ananatis PA13 chromosome, complete genome
ATGGATAACCGTGCGGCCCGCGTGGGCGATGAGATCATTCATTCCAGCATTTTCGCTGATATCACCAGTA
TTGTCGCTGAGGGCGCAGCCTACGCGGTGATCGGTGCGGCGGTCGGTGCGGCGGCAACAGCAGCAGCACC
ATTGCTGGGGGCAGGAATGGCTGCGGCAGGCGTCGCAGCCATTGGTTCCAGCTGTCTGCTCAGCGGCATT
ATTGGCGGTGTATTAGCGAATGCTGCGGGCATTTCGGATGACATCACTAAAGCGGCCGATGGGCTGGGAG
ACATGATATTCCCGCCTTCTCCAGCCGGTGTGATCGCCAGCGGATCAGAGAATGTTCACGTGAATGGTCT
TTTAGCTGCACGCGCGGCCGGGATGCTTACGCCCGGAGATACGCCGCCACCGGAACCGCAATCGCCCAAG
AGTTTCGCAGACTATGGCGGCATGCTGCTCTCTGCGGTGGGTCAGTTTGGCAGTGCAATGTGGCAACCCA
CGGTAGCCTCCGCCGACGCTGGCACCTCTCCGCTGGAACAGGACAAAGTGGCCTGTGAAAAGCACAGCGC
ACCGCAATATCTGGCGCAGGGATCGAAAAGCGTCTTTATCAATGGCCAGCCTGCGGTGCGCGCAAAGGAT
AAAACCACCTGTGATGCCACCGTGAGTGACGATGTTTCCCCCAATGTCATCATTGGTGGTGAAACCGTCA
CTGTAAGAGAGATTAAAAGTGGCAAGGTGCCAGGTCTGGCCGTGATGATGATCGGCCTTTCCCTGATTCG
TGGTCGCCCCAGCCAGATTCTGAAAAACATGCCCTGCGCACTTGCTGGCGCGGTCGGTGGGATGATGGCG
GATATGGCGATCAACGCCGCCTTCTCATCGCTGTTTCCGGTTCATGCCTCCACGGGCGTCAAAGTGCTTA
ATGATGATGCCGAGCGCGATTTCTCCCTTCCTGGTCGCTTCCCGCTCAGTTTCCAGCGTAGCTATAACAG
CCTGACCCAGCGCAGCGGATTATTTGGTCTGGGCTGGGCGACGGTGTTTGACAGCTATATAACGCTGGAT
GGCAATCAGGCGACCTGGTTTGATGACAACGGGCGCGAGCTGAGCTTTGCGGTTCCCGGTGAAAAAGAGG
TGCTCTACAGCATCAGCGAAGGGCTGATGGTAAGGCGCAACGAACTGGGTGATGTCGCCATTGCCGACGA
CGACGGTGCGGTATGGCGTCTGTACAGACGTACGGCCGCTGATCCGCAAGTGCTGCGGCTGGCTTCTCTG
AGCGACGAGTACGGCAATGCGCTGGAGATGGGCTGGGACGAGCAGGCTCGTCTGGTGCGCATTCATGACG
CGCCGCTGGCTATTGATGTCACCCTGCATTACGACGACAAACAGCATGCACAGCGCCCGACCTCGGCCAG
CCATTTTGATGGTGAGCAGCAGTGGCCATTAACGCACTGGACTTATAATGAACAGGGCCAGCTTGCCAGC
GTCACCGATGCCGCAGGCGTTGTCTCGCGTCGTTTCCGTTACAACGATGACGGGTTAATGGTCTGGCATC
AACTGCCGGGCGGGCTGGAAAGCGAATATCGCTGGCAGAAGCTGGATCACTGGCGCGTCGTTGAAAACCG
CACCAATACCGGTGACGGCTGTCACATGCATTATGATCTTGATGCTGGCATCACGCGCGTATCGACCTAT
GACGGTCAGCAGCGAGAACATCACTGGAATGCTGCAGGGCTCATCACCTGCTTTATTGATGAGCGGGGCG
AGACCTGGCGCTATGAGTGGGATGAAAACGAACTCCTGACGCGCCGTATCGATCCGCTGGGTAATGCGGT
GAGCTTCACCTATGACGATCTCGGCAACCGTGTAGAGGAGAAAGATGCGGACGGCGGTGTACAGGCGGTG
CAATGGCTGTCACACCGTTCTCTGCCCACGGTCGTTGCCGGGGCTGACGGTGCCACCACGAAATACTATT
ACGATCCCCATCATGGCCTTGAGCGCGTGGTTGATGCGCTCGGGCAGAGTACCTTCTATAAGCGGGATGA
GTTTGGGCTGGTTGTCGAAGAGATTGACGCGGCAGGCAACAGCTATCGTCGTGAATTCAATGATGCCGGC
CAGGTTATCCGCGAAACAGACTGTTCAGGGCTGACGACGCGCTACCGCTATCATCCCCTTGGCTGGCTCA
GCTGTGTGACTGCGCCGGATGGTGAAGAAACCCGGTATCACTATGATGCAGCGGGCCGTCCTGTTCTGCT
GGAGCGGGCAGAGGGCTGGGAAGAGCGATTGCGCTGGAGCGACAACGGCCTGCCACTGGCCCACGAGTCA
GCGGATGGTAAACGTAGTGAATTCCGCTACGACAACGTCGGACGCTTAATCGCCAACCGTAATGCCCAGG
GCGAGACGGTTCAGCGCAGCTGGGACAGCCGTGGTCGGTTGACAGCGCTGCAAAACGAGAACGGCGAGCA
GTATCAGTTCGAGTGGGGCGCAGATTCCCTGTTGCTGGCCCAGGTTGGGCTGGATGGCGTTGCCACGCGA
TATGACTATGATGCGGCGGGCCGTACGGTATCACGCACCTTTGCCGCCGGACATCCTCAGTCCATTACCC
ATCGCTATCACTGGAGCCGGGCGGGACAACTGCTGGCGCGGACCACGCCGGAAGGCCAGACGCGCTATCA
CTACAGCGGTGGTGGGCAGTTAAGTAAAGTGTCGCAGCATCTGCCGCTGTCTGACACCGAGTGGAGCCAG
CAGGCCGAGCAGGAGATTGCGTTTACCTATGATGCGCTGGGCCGCATCCTAGGTGAGCAGGGTGAACAGG
GCGCGCTGGCCTGGGATTACGACGCGCTGGGTAACTGCACGGCCTTAACCCTGCCGGATGGTCGCAACCT
GAAGCAGCTTTACTACGGCAGCGGCCATTTACTGAGCATCGCGCTGGACAACCTGCCGGTCACCGAGTTT
ACCCGTGACACATTGCATCGGGAACTCAGCCGCACGCAGGGCGGCCTGACCACGCGCAGTGAGTATGACC
GGTTAGGCAGGCTGCGCCGCCGTGACGTTTTCAAAGGTGAAGCACAGCGTCCTGCGCCGCGCGTCTGGTC
CCGTCGGCGGGACTTCGATTACGGCAACAACCTAATCCGTGAAGAGCGCGACGATAACCCGTTCAGCCAG
ACATTATGGCACTACGATAACGCCGGTCGGCTGCTGTCTCAGGAAGGCGCGCAGCCGGGTAATGAGCAGT
GGCGCTGGGATGGCGCAGGCAACCCGCTGGATCGCCATGCCGCTTCCCATATCATGCATAACCGTGTCAC
TGAACTGAACGGTATCCGCTGGCAGTACGACATTCATGGCCGCACCACCGAAAAGGATGACGGCCAGACC
CGCTGGCGCTACCGTTACGATGGTGAGCACCGCCTGACGGATGTCATCAGCGAACCGCGGGACCGCAATA
AGCCACGTACTAAGGTGAGCTTCCGCTACGATCCGCTGGGTCGACGCATCAGTAAAACCCGCCAGCAACT
GTTACAGGGCAGGCCGTCTGGCAAGGCCATCACAACGCGCTTTGTCTGGGAAGGCTATCGTCTGCTGCAG
GAGATCCACGACGATACTCCACTTACCTATGTGTACAGCGACAGCCAGAGCTATGAGCCGCTGGCCCGTA
TTGATGGCGTGGAAAGCCCGGAGATATTCTGGTTTCACTGCGCCGCGAATGGTACGCCCGAGCTGCTGAC
CGACGTTGAAGGCCAGAAGACCTGGGAAGGTGTGAACAGCCCATGGGGCAAACTGCTGCGCGAGTCTAAC
CAGCGAATTCCGGTGGTGGAGCAGAACCTGCGTATGCAGGGCCAGTACCTGGACCGTGAAACCGGGCTGC
ACTATAATCTGTTTCGCTACTATGACCCGGACAGCGGCCGGTTTACGCAGCATGACCCGATAGGGCTGGC
GGGCGGGATCAACCTTTACCAGTATGCCCCGAATGCGCTGGGCTGGGTGGATCCGTTGGGGTTGATGAAG
TGTAAAAATCCTTCTAAGGAAGCAACAAAATGGCAAGGTCCAAAAAACCCCGATTACCCTGGAATTGACG
TTTACAAGAATAGGAAGCTTAAAAAAGGTACAATTCTCTATGCTCTTTACCCTAACGGTGACCAGCAACC
TGCATATGTAGTGACGTTCCCTACAGTTAATCAGTATAGAGGAGATCCGTTAGGTTATCATCAAGCATTG
CAAGTTAAATTGGACCCACGCTGGCCTATGCGTACGAAATTAAGAGCATTTTATGTAAGCGAAGACATTG
ACGTTGCTTACGGTAGAGCTGCAGCGAATAAAATGTATGGCGATGGCGGGGGACTTCAGTTCTTCATACC
AGAGGAATTGAGACATTTGTTAATCCCAGGGAAAATTATTGATATATGA