SecReT6
Effector Protein ID: 386080271
-
SecReT6 ID617
T6SS typeA3
Gene symbol-
Locus tagPAGR_g3082
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]3340739..3344899 [+]
Productputative membrane-bound sugar-binding protein RhsD
Effector typeProtein
Homologous effectorECL_03140
DescriptionrhsB
UniProt IDG7UDE0
KEGG IDpaq:PAGR_g3082
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 367..394
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 421..442
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 509..525
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 549..569
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 597..629
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 636..672
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 699..732
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 720..755
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 741..777
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 808..824
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 864..897
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 927..953
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 982..1006
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 998..1028
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 1074..1106
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 1133..1144
RHS_repeat [PF05593], Evalue: 3.10E-40, Aligned region: 1173..1196
PAAR_motif [PF05488], Evalue: 2.10E-16, Aligned region: 4..14
PAAR_motif [PF05488], Evalue: 2.10E-16, Aligned region: 83..155
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 723..752
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 760..770
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 1053..1064
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 1095..1102
RHS [PF03527], Evalue: 3.50E-13, Aligned region: 1165..1202
Tox-HNH-EHHH [PF15657], Evalue: 1.40E-09, Aligned region: 1308..1370
DUF4595 [PF15283], Evalue: 1.80E-05, Aligned region: 375..402
DUF4595 [PF15283], Evalue: 1.80E-05, Aligned region: 418..448
DUF4595 [PF15283], Evalue: 1.80E-05, Aligned region: 605..680
DUF4595 [PF15283], Evalue: 1.80E-05, Aligned region: 857..872
DUF4595 [PF15283], Evalue: 1.80E-05, Aligned region: 996..1089
DUF4150 [PF13665], Evalue: 0.0015, Aligned region: 83..111
DUF4150 [PF13665], Evalue: 0.0015, Aligned region: 120..155
Protein Sequence: 1386 a.a.     [Download]
>gi|386080271|ref|YP_005993796.1| putative membrane-bound sugar-binding protein RhsD [Pantoea ananatis PA13]
MFEAARLGDDIGHSHALAGMIAGTIVGGLIAAAGGIAAGALMIAGIGASCLGVGVLLVGLSIGVGYLTGE
LATAARDGIADAGAASMTPKGKITTGSPNVFINSKPAAMATNSIVACKDDGPQQMAEGSSRVYINGLPAS
RIDDRTTCDAKVMTGSDNVYIGGEPEQTLPVQPEVPEWVYKASDLTLLFAGLAGGVGGAAGKVGALGKLL
SKIPGINKIARVACRAGALMTGVAAAGILARPVDIVSGQKFLSGDDELDFVLPSRLPLRWQRYWRSGNPG
DSVLGRGWNLFWETRLERYQDGLVWRAPSGDYVSFPLVPKGQRTYCEAEKRWLEHHRDDSWSLYDISGER
WHFMPLRDDAPSLPLCLTEPCGNEIQFDWNPDHTLAALTDSAGQRVTCRYANNRLAGAWLDDDICLVSYA
YDDIGQLVTVTGRGGSVRRRFQWRDGLMVAHEDMNGLISEYRWQEIDGLPRVVAFRHSGGEQLDFEYDFD
NGIRRARRDDGVEAHWLIDDDDHVARFTDFDGRQTMLVYRAGELCDVIMPGGAMRCSNWDRYGRMTQEID
PVGRRTTYHWFRMTDRVIRTDYPDLSAAQAAYDLNVRLLTETDALNNVTTYHYPDDTELLPDSITDATGG
VVKLEWNRQGLLTQRTDCSGSVTTFSYDRFGQLVRSVDAEGHVTQREWNDKGQLCAIIHSDGSRETLHWN
TQGQLSAWRDPLETEVRWTYNALGLPVSLTDRIGRTRRWHYDARGNLLRLENGNGGDYRFTCDPLGRPLS
EIRPDKTSRNMEWNARGFLIGLQENGQPANDGGIARRWQRFSYDDSGLITQRTTQHAEYHYRRHRSGQLA
SLVRTPTSDGMALGIEDDEIAFTYDVAGQLLTEAGINGKLDYEWDALGNLTHLTLPGEQQLAWLHYGSGH
VSAIRFNQQLVSEFTRDRLHREIRRSQGAREQARQYDSLGRRTMQRSELHSEVVLPEKAILERAFRYSAR
SELESVSDTLRGDIIYGYDDEGRLLKHYEARQGHSTSHFAYDNADNLAANDDALHALPVTDNRLHHWQNL
FMKYDDWGNLVSRRSGLHEQHFTYDAENRLISAKGNGPDGGFTAHYHYDALGRRTRKVVSTQHDRKEVRF
LWQGYRLLQEQHENGQCQTYVYDPNEAWSPLARIDHMAAGERGDVLWFNTDLNGAPLEVTDERGDIRWSG
QYGSFGEVRRQTEGFTRLAKQSALPHQPLRYAGQYADSETGLHYNLFRYYDPQVGRFTVQDPIGLEGGWN
LYQYAPNPLSWVDPLGLSNLSTTFKAMFREAKRKLGIPKNTNTPQAIKVFDSKYENRTVWEFNHNGDKKY
IIMHEDDKFGRGPHLHTADDLHGNPLDKNVRYNQHPGHIPENKIGITDMRGKKRCP
-
Nucleotide Sequence: 4161 bp     [Download]
>gi|386077236|ref|NC_017554.1|:3340739-3344899 Pantoea ananatis PA13 chromosome, complete genome
ATGTTTGAAGCTGCACGCCTCGGCGATGATATCGGTCACTCTCATGCCCTGGCGGGCATGATTGCAGGCA
CTATCGTCGGTGGACTGATCGCTGCGGCGGGCGGTATTGCTGCGGGTGCATTGATGATTGCCGGGATAGG
CGCCTCCTGCCTTGGCGTGGGCGTATTGCTGGTTGGACTCAGTATCGGCGTGGGTTACCTTACTGGCGAA
CTGGCCACCGCCGCGCGAGACGGAATAGCGGATGCTGGGGCGGCCAGCATGACCCCAAAGGGCAAGATTA
CCACCGGTTCGCCCAACGTCTTTATTAACAGTAAACCCGCCGCCATGGCCACCAACAGCATAGTGGCCTG
CAAGGACGATGGTCCGCAGCAGATGGCGGAAGGCTCCTCCCGGGTGTATATCAACGGCCTGCCTGCATCA
CGCATCGACGATCGCACCACCTGCGATGCCAAAGTGATGACGGGCTCTGACAACGTCTATATCGGCGGCG
AGCCTGAACAAACGCTGCCTGTCCAACCTGAAGTGCCCGAATGGGTTTATAAAGCCTCCGATCTTACCCT
GCTGTTTGCCGGGCTGGCCGGTGGCGTGGGCGGTGCGGCTGGCAAGGTCGGCGCGCTGGGTAAATTACTG
AGCAAGATTCCCGGTATCAATAAAATCGCCCGGGTGGCCTGCCGTGCTGGTGCCTTAATGACCGGTGTGG
CGGCCGCAGGTATTCTTGCCCGTCCCGTTGATATCGTAAGCGGCCAGAAGTTTCTTAGCGGCGATGATGA
ACTGGATTTTGTGCTGCCCTCCCGGCTGCCGCTACGCTGGCAGCGCTACTGGCGCAGCGGTAATCCCGGC
GACAGCGTATTAGGCCGTGGCTGGAACCTGTTCTGGGAAACACGGCTGGAACGCTACCAGGATGGGCTAG
TCTGGCGTGCGCCCTCCGGCGACTACGTCTCTTTTCCTCTGGTGCCCAAAGGCCAGCGTACCTACTGCGA
AGCGGAGAAACGCTGGCTGGAACATCATCGGGACGACAGTTGGTCATTGTATGACATCAGCGGTGAGCGC
TGGCATTTTATGCCCCTGCGCGATGATGCCCCTTCTCTTCCCCTCTGCCTGACCGAGCCCTGTGGCAATG
AGATTCAGTTCGACTGGAACCCCGATCACACATTGGCTGCGCTGACAGACAGTGCCGGTCAGCGCGTAAC
CTGCCGCTATGCGAATAACCGGCTCGCAGGTGCCTGGCTGGATGACGATATTTGTCTGGTCAGTTACGCT
TATGATGATATCGGCCAACTCGTTACGGTAACGGGCCGGGGCGGTAGCGTGCGCCGACGCTTCCAGTGGC
GCGATGGCCTGATGGTGGCCCATGAAGATATGAATGGCCTGATAAGTGAGTATCGCTGGCAGGAGATCGA
TGGCCTCCCAAGAGTGGTGGCCTTCCGTCACAGCGGCGGCGAGCAGCTGGATTTTGAGTACGATTTTGAT
AATGGCATCCGACGCGCGCGACGTGATGACGGCGTTGAAGCTCACTGGCTCATTGACGATGACGATCATG
TCGCCCGCTTCACCGACTTCGATGGCCGCCAGACCATGCTGGTTTACCGCGCAGGCGAGTTGTGCGATGT
GATTATGCCCGGCGGTGCCATGCGCTGCAGCAACTGGGACCGCTATGGCCGCATGACGCAGGAGATCGAT
CCGGTCGGACGTCGAACCACTTATCACTGGTTCCGCATGACCGACCGCGTGATCCGTACGGACTATCCCG
ATCTGAGCGCGGCTCAGGCGGCTTACGATCTTAATGTTCGCCTGCTGACTGAAACCGATGCGCTCAATAA
CGTCACCACCTATCACTACCCTGATGACACAGAACTGCTGCCAGACAGCATTACCGATGCAACGGGCGGC
GTGGTGAAGCTGGAATGGAACCGACAAGGGCTGCTGACGCAGCGCACCGACTGCTCTGGCAGCGTAACGA
CGTTTAGCTACGACCGATTTGGCCAGCTTGTTCGCAGCGTGGATGCTGAAGGTCATGTCACCCAGCGCGA
GTGGAATGACAAGGGACAACTCTGCGCCATCATCCATTCAGACGGTAGCCGGGAAACCCTGCACTGGAAC
ACCCAGGGGCAGCTCAGTGCGTGGCGCGATCCGCTGGAAACCGAAGTCCGCTGGACCTATAACGCACTCG
GATTACCGGTAAGCCTGACGGACCGCATTGGTCGCACGCGTCGCTGGCATTACGATGCCCGCGGTAATCT
GCTGCGGCTGGAAAACGGCAACGGCGGTGACTATCGCTTTACCTGCGATCCGCTCGGCCGTCCATTGAGT
GAGATCCGGCCCGATAAGACCTCACGCAATATGGAATGGAATGCTCGTGGCTTTCTCATTGGTTTACAGG
AAAATGGCCAGCCCGCTAATGACGGTGGCATAGCTCGACGCTGGCAGCGCTTTAGCTACGACGACAGCGG
CTTGATTACCCAGCGCACAACGCAGCATGCTGAATACCACTACCGGCGTCATCGTAGCGGTCAACTTGCC
AGCCTGGTTCGCACGCCGACCAGCGACGGAATGGCGCTTGGTATCGAAGACGATGAAATCGCCTTTACCT
ATGACGTCGCAGGTCAGCTGTTAACAGAAGCTGGTATAAACGGGAAACTGGATTACGAATGGGATGCGCT
GGGCAACCTCACCCATCTGACCCTGCCGGGTGAACAGCAACTTGCCTGGCTGCACTACGGTTCGGGTCAC
GTCAGCGCGATTCGCTTTAATCAGCAACTGGTCAGTGAATTTACCCGCGACCGCCTGCACCGGGAAATTC
GCCGCAGTCAGGGCGCGCGTGAGCAGGCGCGTCAGTACGACAGCCTTGGCAGGCGCACGATGCAGCGCAG
TGAATTGCATAGCGAGGTGGTGCTACCGGAAAAAGCCATTCTGGAACGCGCTTTCCGCTATTCGGCGCGC
AGTGAACTGGAGTCTGTCAGTGATACGCTGCGCGGCGACATTATCTATGGTTACGATGATGAAGGCCGCC
TGCTGAAGCACTACGAAGCCAGACAGGGCCACAGCACCTCGCATTTTGCTTACGATAACGCGGACAACCT
GGCGGCAAACGACGATGCACTGCACGCGTTGCCAGTTACCGACAACCGTCTGCATCACTGGCAGAACCTG
TTTATGAAGTACGATGACTGGGGCAACCTGGTCAGTCGACGCAGCGGCCTGCATGAGCAGCATTTTACCT
ATGACGCCGAAAACCGGCTCATCAGCGCCAAAGGCAATGGCCCGGACGGCGGGTTTACCGCACACTATCA
TTATGATGCGCTGGGCAGGCGCACCCGCAAAGTGGTCAGCACCCAGCACGATCGTAAAGAAGTCCGTTTT
CTGTGGCAGGGCTATCGCCTGTTACAGGAGCAGCATGAAAACGGCCAGTGCCAGACCTACGTGTACGATC
CCAACGAGGCCTGGAGCCCGCTGGCGCGCATCGACCATATGGCAGCAGGCGAACGGGGCGATGTGTTGTG
GTTCAATACCGATCTCAACGGGGCACCGCTAGAGGTAACCGATGAACGCGGCGACATCCGCTGGAGCGGT
CAGTACGGCAGCTTTGGTGAAGTGCGTCGGCAGACAGAGGGCTTTACCCGGCTGGCAAAACAGTCTGCCC
TGCCCCATCAGCCGCTGCGCTATGCGGGCCAGTATGCGGACAGCGAAACCGGTCTGCATTACAATCTGTT
CCGCTATTACGATCCGCAGGTGGGAAGGTTCACGGTTCAGGACCCGATAGGGCTGGAAGGCGGCTGGAAC
CTTTATCAGTATGCGCCGAACCCGCTGAGTTGGGTGGATCCGCTGGGGTTGAGTAATCTGTCCACAACTT
TCAAAGCTATGTTTAGGGAAGCTAAAAGGAAATTAGGTATACCTAAAAATACAAATACACCACAAGCTAT
AAAAGTTTTCGATTCTAAATATGAAAACAGAACAGTCTGGGAATTTAATCATAACGGTGATAAAAAATAT
ATCATCATGCATGAGGATGATAAATTTGGCAGGGGCCCTCATTTACACACTGCCGATGATTTGCATGGAA
ACCCATTAGATAAAAATGTCCGTTACAATCAACATCCAGGACATATCCCCGAAAATAAGATTGGAATTAC
AGATATGCGAGGAAAAAAAAGATGTCCTTGA