SecReT6
Effector Protein ID: 386309011
-
SecReT6 ID618
T6SS typeA3
Gene symbol-
Locus tagY11_15681
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1571405..1571890 [-]
Productprotein ImpD
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDE7B4M5
KEGG IDyey:Y11_15681
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|386309011|ref|YP_006005067.1| protein ImpD [Yersinia enterocolitica subsp. palearctica Y11]
MSQDMFIKIDGIEGESLDANHKNEIQVLAWKWDVSQHSNMHSGSGGGSGKATVSDFCVTHYIDKASPNLL
SYCLLGKHIKNIQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANQQS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1571890-1571405 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGTCGCAAGATATGTTTATTAAAATTGATGGTATCGAAGGTGAATCTTTAGATGCTAACCACAAAAACG
AAATTCAGGTGCTGGCTTGGAAATGGGACGTTTCTCAGCACTCAAATATGCACAGTGGCTCAGGCGGTGG
TTCAGGTAAAGCAACTGTTTCTGACTTCTGTGTCACGCATTATATCGATAAAGCAAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCATATTAAGAATATCCAATTCGTTCTGCGTAAAGCAGGTGGCGATCCAC
TGGAATACCTGACTATTAAATTTACCGATGTAATCATCACTCGTGTTGATATGGCCGGTTCTCTTGAAGA
TGAAACTCGTCCACGTGAAGAAATTCGTTTCTCATTCACCAAGATGACTCAAGACTACGTTATGCAGAAT
GCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACCAGCAAAGCTAA