SecReT6
Effector Protein ID: 386324515
-
SecReT6 ID619
T6SS typeA5
Gene symbol-
Locus tagSbal175_2058
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2436816..2437295 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVPA1027
DescriptionHcp protein
UniProt IDG0AYA0, G0AYA0
KEGG IDsbb:Sbal175_2058
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-30, Aligned region: 6..133
Protein Sequence: 159 a.a.     [Download]
>gi|386324515|ref|YP_006020632.1| hypothetical protein [Shewanella baltica BA175]
MQANTYLDYEGIKGEATAEAFKDMITVLSMDWGSQREISSHTGTAMDREASSTRLSDVVITKLQDKSSPD
FFKEATIGKGKKAIFHITKQGDKIEEIMKIELTDAMVSSYHMSVSGDRPVETIVISYTELMMTVVPTDDK
NNVSAPQVYGYSGVKGQKL
-
Nucleotide Sequence: 480 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2436816-2437295 Shewanella baltica BA175 chromosome, complete genome
ATGCAAGCTAACACATATTTGGACTACGAAGGGATTAAAGGCGAAGCAACTGCAGAAGCTTTTAAAGACA
TGATTACTGTTCTATCTATGGATTGGGGTTCACAACGTGAAATCTCTTCTCATACTGGTACTGCTATGGA
TCGTGAAGCTAGTTCAACTCGTTTGAGCGATGTTGTCATTACCAAGTTGCAAGATAAATCTTCTCCTGAT
TTCTTCAAGGAAGCGACTATTGGTAAAGGTAAGAAAGCAATTTTTCATATCACTAAACAAGGTGATAAAA
TTGAAGAAATCATGAAAATTGAACTAACTGACGCCATGGTAAGTAGCTACCACATGTCAGTTTCTGGTGA
TCGTCCAGTTGAAACAATTGTTATTAGTTATACAGAGCTAATGATGACAGTTGTACCTACAGATGACAAA
AATAACGTATCTGCACCACAAGTTTATGGTTACAGTGGCGTTAAAGGCCAAAAGTTATAA