SecReT6
Effector Protein ID: 386603124
-
SecReT6 ID625
T6SS typeA2
Gene symbol-
Locus tagUM146_02455
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]526319..528088 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorAHW84487
DescriptionTle4
UniProt IDE1S0A7
KEGG IDelu:UM146_02455
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 25..37
PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 227..263
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 245..296
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 381..424
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 526..565
Abhydrolase_6 [PF12697], Evalue: 0.0028, Aligned region: 240..272
Protein Sequence: 589 a.a.     [Download]
>gi|386603124|ref|YP_006109424.1| hypothetical protein UM146_02455 [Escherichia coli UM146]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERK
RLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDR
GWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVH
VVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGV
LPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRD
GSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGRLDLNEVGNIR
TIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYR
NPVSQAFALRSIIKIAQEVKKDGKMSYSD
-
Nucleotide Sequence: 1770 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c528088-526319 Escherichia coli UM146 chromosome, complete genome
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTAC
GGGTTATTCCGGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCAT
CTGGCGATATGATGACTCTATGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAA
AGATTATTGCATCCTGACAGGGTGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAG
AAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACAC
TCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGC
GGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGG
ACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCAT
GTCGTTGGCTATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAA
TTGTTGGAGGCTATCAAAAACGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGG
ACTAGTGGCAAGGTACTTTTCAGAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTA
TTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATC
CGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTC
GCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGAT
GGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGAAATTGGTGGATGAGAATCTATTGAATCCTTTTAATAC
TTCATTAAATCAAAAGCAAATTGATACTGATTGGAATATATATGAAAATTTAATTACTGAGAGTGTCAAT
CCATTTCATAAGCAAATTGCTGGAAAATATCATATCAATACTTACTCTTTCTATGGGAGAGCGAAATTGG
GAGATATTCCTGAAGCGCATTTAACGCAGGAAAATGTTCTTTGGAAAGGCTCATTATCAATGGGAAAAAA
AAGTGATATATCTTTAGAACCAAAATTCATTGATGGTCGTCTTGATTTAAATGAAGTTGGTAACATTAGA
ACTATTAAGGATGAATTTTCTCCTGAAGAACAGGCGTGGGAAATAAATACTGACGACGGTGATACATATG
TTAAGATAGGACAGCGTTTTACATTACGAGACTCTTGTGAAAACGGGGATGGTACAGTACCTCTTCGTGC
AGGACAAATCGTACACAAGAACATCCTAGAGCGTTTGGCTGTACAGGTTTCTCACGAGGCTGCTTATCGA
AATCCCGTTAGTCAGGCATTTGCATTACGTTCTATTATAAAAATAGCTCAGGAGGTAAAAAAGGATGGTA
AAATGTCATACTCTGATTAA