SecReT6
Effector Protein ID: 386603127
-
SecReT6 ID625
T6SS typeA2
Gene symbol-
Locus tagUM146_02470
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]533437..533928 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE1S0B0
KEGG IDelu:UM146_02470
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386603127|ref|YP_006109427.1| hypothetical protein UM146_02470 [Escherichia coli UM146]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c533928-533437 Escherichia coli UM146 chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCGGAGTTTAAATTCTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTATTTCAATACCACGCTGGATAACGTCAAGCTGGTCAGAGTAGCTCCGCT
GATGCACGACATCAAAGATCCGGGTAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA