SecReT6
Effector Protein ID: 386610183
SecReT6 ID630
T6SS typeA2
Gene symbol-
Locus tagECW_m3033
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3107231..3107722 [+]
ProductSecreted protein Hcp
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE0J227
KEGG IDell:WFL_14800, elw:ECW_m3033
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386610183|ref|YP_006125669.1| Secreted protein Hcp [Escherichia coli W]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKEPSKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3107231-3107722 Escherichia coli W chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGCAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCCTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCAGTCACCACCGGCCAGACCCTGAAAACGGCGGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTGGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
GATGCACGACATCAAGGAGCCTTCCAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAACGTCCTTCCGCCT
GA