SecReT6
Effector Protein ID: 386700268
-
SecReT6 ID637
T6SS typeA2
Gene symbol-
Locus tagKO11_08860
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1885630..1886121 [-]
ProductHcp-like protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE8Y7C4
KEGG IDekf:KO11_08860, eko:EKO11_0949
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386700268|ref|YP_006164105.1| Hcp-like protein [Escherichia coli KO11FL]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKEPSKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1886121-1885630 Escherichia coli KO11FL chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGCAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCCTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCAGTCACCACCGGCCAGACCCTGAAAACGGCGGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTGGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
GATGCACGACATCAAGGAGCCTTCCAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAACGTCCTTCCGCCT
GA