SecReT6
Effector Protein ID: 386744116
-
SecReT6 ID640
T6SS typeA1
Gene symbol-
Locus tagS70_13845
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2948907..2949425 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorABG57132
DescriptionHcp protein
UniProt IDI0DW86
KEGG IDpsi:S70_13845
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|386744116|ref|YP_006217295.1| hypothetical protein S70_13845 [Providencia stuartii MRSN 2154]
MPTPCYISIEGKTQGNITAGAFTPESVGNIYVQGHEDQMLVQEFSHIVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQ
LIEVSLSYRKVDWEHTVAGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2949425-2948907 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGCCAACTCCATGTTATATCTCTATCGAAGGTAAAACGCAGGGCAACATCACTGCGGGAGCATTTACCC
CTGAATCCGTCGGTAACATCTATGTACAAGGTCATGAAGACCAGATGCTGGTACAAGAGTTTTCCCACAT
TGTGACCGTACCGACTGACCCCCAATCCGGTCAGCCTTCAGGCCAACGTGCTCACAAGCCATTCCGTTTT
ACTGTGGCATTAAACAAAGCGGTACCACTGCTGTATAACGCACTGGCGTCCGGCGAAATGCTGCCAAAAG
TGGAACTGAAATGGTATCGCACGTCTGTTGAAGGGAAACAAGAGCATTTCTTCACCACCACACTGACGGA
TGCGACTATCGTTAACATCGATTGCCAGATGCCGCATTGCCAAGACCCAGCGAAAGCCGATTTCACGCAG
CTTATCGAAGTGTCTCTGTCTTACCGTAAAGTGGACTGGGAACACACGGTTGCAGGCACATCAGGTGCCG
ATGACTGGCGCGCACCGCTCGAAGCGTAA