SecReT6
Effector Protein ID: 386744289
-
SecReT6 ID640
T6SS typeA1
Gene symbol-
Locus tagS70_14750
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]3128043..3130199 [-]
ProductRhs family protein
Effector typeProtein
Homologous effectoridrB
DescriptionVgrG
UniProt IDI0DWQ9
KEGG IDpsi:S70_14750, psi:S70_11165
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-54, Aligned region: 27..64
Phage_GPD [PF05954], Evalue: 5.80E-54, Aligned region: 118..409
Phage_base_V [PF04717], Evalue: 9.30E-17, Aligned region: 451..539
Gp5_C [PF06715], Evalue: 0.0011, Aligned region: 581..602
Gp5_C [PF06715], Evalue: 0.0011, Aligned region: 600..618
Acetone_carb_G [PF08882], Evalue: 0.0069, Aligned region: 294..327
Protein Sequence: 718 a.a.     [Download]
>gi|386744289|ref|YP_006217468.1| Rhs family protein [Providencia stuartii MRSN 2154]
MFSKDPKKSSPDLASMLKDEAINQAKEAAMSKASARTQQAVNLAQQAASAASSLQASAAMLTPGGGLTGG
LNPADPDTAQAALRSALGLTAEPSGLVFTCEIGLFPAGTFQVTDFTLTEGLSSLYHLSLNVVSLLPYIEF
QTHLGQAASLTVKRDGQIVRTVNGILAGGVQGNTDGVKTWYHFDIRPEMWIMTLNQDSRIFQDQNAPAIL
KTLLDEAHVKSDCLFYREALHPERTYTTQKRESTYDFWCRLAFEEGINFWFEEDQMFYSDEHMGMTAGIS
LTYNPQANTDITDSTATTWQYGEYLCPDQLIQKDNNYVRPSYPLMHQDQQAGGGQHSVFESYGRFQLDAE
GEPLTKARFEQLRSGSRVGNATTNCFALRPGKIFTLQNHPHAPMNDSWQVITVTHHGVQPLADNGGGEGT
QLSNTVSFIPGREEWRPPHRYKPTADGDELATVVGPPGEEIYVNEYGAVKVHFHWDRYGKPDHSASCWVR
VAMGWSGNGYGFSAVPRIGTVVQVSYLNGDIDRPIITGCTYDGRNAPPIRFPENKTRTTFRTQTHKGEGF
NELRFEDEDGKQEVFIHAQKDMNTVVRDNRSTTVGANHKEVILQNQTVSVHGSQSTSVQSDQKNVVFGNQ
QSIVDGEVVIASAKGIRLISGTSVLQLSPSGRVTIACENFDFYASGSGQIATGEILDLNMDNAAPGITKI
DPNTDTIASTKSQFFPEK
-
Nucleotide Sequence: 2157 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c3130199-3128043 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGTTCTCAAAAGATCCGAAAAAATCATCCCCTGATCTGGCGTCGATGCTGAAGGACGAAGCCATTAACC
AAGCCAAGGAAGCGGCGATGTCAAAGGCATCTGCGCGAACACAACAAGCCGTCAATTTGGCCCAACAAGC
GGCCAGTGCGGCGTCCTCGTTGCAGGCCTCCGCCGCGATGTTGACCCCCGGCGGCGGGCTAACGGGGGGG
CTCAACCCTGCCGATCCGGATACCGCGCAAGCGGCCTTACGCAGCGCGTTAGGGTTAACCGCCGAGCCGA
GCGGTTTAGTGTTTACCTGTGAAATCGGCTTATTTCCTGCGGGCACCTTTCAAGTCACCGATTTTACCCT
CACCGAAGGGCTCTCTTCCTTATATCACCTTAGCCTGAATGTGGTGAGTTTGTTGCCTTATATTGAATTC
CAAACGCATTTAGGCCAAGCCGCCTCACTGACGGTCAAACGGGATGGGCAGATTGTGCGCACCGTCAATG
GCATTCTTGCGGGCGGTGTCCAAGGCAATACCGATGGCGTGAAAACGTGGTACCATTTTGATATCCGCCC
TGAAATGTGGATCATGACCCTCAATCAGGACAGCCGTATCTTCCAAGACCAAAACGCCCCCGCGATTTTA
AAGACGTTATTGGATGAAGCGCACGTCAAATCAGACTGTCTTTTTTACCGTGAAGCGCTGCATCCGGAAC
GGACCTACACCACGCAAAAACGGGAATCCACCTATGACTTTTGGTGTCGCTTAGCCTTTGAGGAAGGGAT
CAACTTCTGGTTTGAAGAAGATCAGATGTTCTACAGTGATGAGCACATGGGCATGACCGCGGGGATCTCG
TTGACTTACAACCCGCAAGCGAACACCGATATCACCGACAGTACCGCCACCACCTGGCAGTACGGAGAGT
ATCTGTGCCCCGATCAACTGATCCAAAAAGACAACAACTACGTGCGCCCCTCTTACCCGCTGATGCACCA
AGATCAGCAAGCAGGCGGTGGGCAGCACAGTGTGTTTGAAAGTTACGGGCGTTTTCAATTGGATGCCGAA
GGGGAGCCCCTGACCAAAGCCCGTTTTGAGCAGTTACGCAGCGGCAGCCGCGTGGGCAATGCCACCACGA
ACTGCTTTGCCTTGCGCCCAGGCAAAATTTTCACCCTGCAAAATCACCCACACGCCCCGATGAATGACAG
TTGGCAAGTCATCACGGTCACCCATCACGGCGTGCAACCCTTAGCCGACAATGGCGGGGGCGAAGGAACG
CAATTAAGTAACACGGTCTCCTTTATACCGGGTCGTGAGGAGTGGCGTCCGCCACACCGTTATAAACCGA
CGGCCGATGGGGATGAATTGGCGACCGTGGTGGGGCCGCCGGGGGAAGAGATTTACGTCAATGAGTACGG
CGCCGTCAAAGTGCATTTCCATTGGGATCGCTACGGCAAGCCCGATCACAGCGCTTCCTGTTGGGTGCGT
GTCGCCATGGGATGGAGCGGCAACGGTTACGGGTTTTCGGCCGTGCCCCGTATCGGCACTGTTGTGCAAG
TCAGTTACCTGAACGGGGATATTGACCGCCCCATTATCACGGGATGCACTTACGATGGCCGCAATGCTCC
CCCTATTCGTTTTCCTGAGAACAAAACACGCACCACGTTCCGCACTCAAACCCATAAGGGCGAGGGCTTT
AACGAGTTACGTTTTGAGGATGAGGACGGTAAGCAGGAAGTGTTTATTCATGCGCAAAAAGACATGAATA
CGGTAGTACGGGATAATCGTTCGACGACCGTGGGGGCCAACCACAAAGAAGTCATCCTACAAAACCAAAC
GGTTTCAGTGCATGGCTCTCAATCGACCTCAGTACAGTCTGACCAAAAGAATGTCGTCTTTGGGAATCAA
CAGTCTATTGTCGATGGTGAAGTGGTCATCGCTTCCGCAAAAGGGATCCGTCTTATCAGCGGTACGTCCG
TTCTTCAATTGAGTCCCTCGGGGAGGGTCACCATCGCGTGTGAAAATTTTGATTTTTATGCCAGTGGTTC
AGGGCAAATTGCCACGGGTGAGATCCTCGATCTCAATATGGACAATGCCGCGCCAGGGATCACTAAAATA
GATCCGAATACCGACACCATTGCCAGCACAAAATCCCAATTTTTTCCTGAAAAATAA