SecReT6
Effector Protein ID: 386860195
-
SecReT6 ID642
T6SS typeA4b
Gene symbol-
Locus tagBP1026B_I0069
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]75957..76397 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDI1WEQ2
KEGG IDbpz:BP1026B_I0069
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0043, Aligned region: 45..123
Protein Sequence: 146 a.a.     [Download]
>gi|386860195|ref|YP_006273144.1| hypothetical protein BP1026B_I0069 [Burkholderia pseudomallei 1026b]
MPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAP
VKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVQQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|386860126|ref|NC_017831.1|:75957-76397 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGCCTTACGTGTCGACCCATTACTCGAACAACGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGA
CTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCA
ATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCG
GTGAAAGGCAACGCGACGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACG
GCCACGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCC
GCCGACGCCGCAGCCGGTTCAGCAACGGCGCCTGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGAT
AACTTCTATGTCGTGGAGTAA