SecReT6
Effector Protein ID: 386864979
-
SecReT6 ID642
T6SS typeA4b
Gene symbol-
Locus tagBP1026B_II1282
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]1604949..1607189 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3226
Description
UniProt IDI1WTD5
KEGG IDbpz:BP1026B_II1282
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.60E-120, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00015, Aligned region: 38..61
Abhydrolase_6 [PF12697], Evalue: 0.00015, Aligned region: 226..311
DUF900 [PF05990], Evalue: 0.0056, Aligned region: 37..46
DUF900 [PF05990], Evalue: 0.0056, Aligned region: 213..283
PGAP1 [PF07819], Evalue: 0.0072, Aligned region: 38..43
PGAP1 [PF07819], Evalue: 0.0072, Aligned region: 249..302
Thioesterase [PF00975], Evalue: 0.0087, Aligned region: 147..188
Thioesterase [PF00975], Evalue: 0.0087, Aligned region: 258..359
Protein Sequence: 746 a.a.     [Download]
>gi|386864979|ref|YP_006277927.1| hypothetical protein BP1026B_II1282 [Burkholderia pseudomallei 1026b]
MNGINDQCFTAARGAGVTMSNRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGAYGGEYAEAIKAKDQKSPFFDSKIANDPDMYLYRRAETGGTHSMFLPFYWGYRASDDEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPDRRYFVLAAARLASLIRTIRAVRPSALALEHGMDPRHETITVMGHSQGTIITLLAQAMLKQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVQKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRRLLLLMADWKMTPDAMDKIAKCNAYG
RLETHTREFIDACAKYYQNGSFPAEKFVPLTLPPLVTSELKVDKRA
-
Nucleotide Sequence: 2241 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c1607189-1604949 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAACGGAATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGTCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGCTTGTCGCGAAGCGAT
CTGCGGCCGGGGGCGTATGGCGGGGAATATGCCGAAGCCATCAAAGCGAAAGACCAAAAGAGCCCGTTCT
TCGATAGCAAAATCGCCAACGATCCGGACATGTATCTGTATCGACGTGCGGAGACCGGCGGCACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAAGATCAGCCATCCGGGC
GAGGTCAAGAGCCGCGTCGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTGGAGCGCACGGTCATGCAAAACGCGCTCGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGATCGCCGCTATTTCGTGCTGGCCGCGGCTCGCCTGGCGAGCCTCA
TCCGGACCATTCGGGCCGTCCGGCCTTCCGCGCTCGCGCTGGAGCACGGCATGGATCCTCGACACGAAAC
GATCACCGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTTGCGCAGGCGATGCTCAAGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTTTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCAGAAGGGCGGACAGGTGCCCGGGCACGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCGGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGT
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGACGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCGGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGCCGGATGCAATGGATAAGATCGCGAAATGCAACGCTTATGGC
CGGCTTGAGACGCATACGAGGGAATTTATCGATGCGTGCGCGAAGTACTATCAAAATGGCTCGTTCCCTG
CGGAGAAGTTTGTGCCGCTTACTTTGCCACCACTCGTCACCAGCGAACTGAAAGTTGACAAGAGAGCATG
A