SecReT6
Effector Protein ID: 386864980
-
SecReT6 ID642
T6SS typeA4b
Gene symbol-
Locus tagBP1026B_II1283
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]1607203..1609989 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDI1WTD6
KEGG IDbpz:BP1026B_II1283
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-57, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 7.00E-42, Aligned region: 614..646
DUF2345 [PF10106], Evalue: 7.00E-42, Aligned region: 699..851
T6SS_Vgr [PF13296], Evalue: 3.20E-39, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 3.20E-39, Aligned region: 740..805
Phage_base_V [PF04717], Evalue: 9.50E-19, Aligned region: 460..546
Protein Sequence: 928 a.a.     [Download]
>gi|386864980|ref|YP_006277928.1| Rhs element Vgr protein [Burkholderia pseudomallei 1026b]
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTRRDLPPGV
LLGIPVSIRLITDRGQPHTVSAIISGVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIEVLAT
LFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQ
GDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESS
VASSLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITL
TGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAYAPRALPSALANDADTRYENTF
ACVRRGVPLVPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAG
DSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSG
IKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAA
QGMLLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTGT
DGAAAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGA
GVQAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKL
LSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLTDL
VKDDAMRIAKIDYLKPKL
-
Nucleotide Sequence: 2787 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c1609989-1607203 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCG
CGTTGCACTTTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGA
AGGGCTGATGACCGGGATCCACGGCCGATTGACCTGCGTGTCGACCCGCCGCGACCTTCCGCCCGGCGTG
TTGCTCGGCATTCCGGTTTCGATCCGGCTGATTACCGACCGCGGACAGCCGCACACGGTGAGCGCGATCA
TCAGCGGCGTCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCT
GTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGAGGTGCTCGCCACG
CTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGC
GCGCCGATCGCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGCCGTTGCAG
GGCGACGCGCCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCA
CGGTCCGCTTGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCG
GCAATTGGCGCCCGGCAAGGCCGGGCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGC
GTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCG
ACATTGCGCACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGA
GTTCGAAGCCGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTG
ACGGGCGATCCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCATG
ACATCTGGAACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCT
CGCGTACGCGCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTC
GCGTGCGTGCGCCGCGGCGTGCCGCTTGTGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATC
TGCTCACGGGCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGT
GCGGGTGCACGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGC
GACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCCATTTCGGCGCATCGTTTCTGCCGCGAG
TCGGCATGGAAGTCCTTCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGG
TAACGGCGCGCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGC
ATCAAGACGAAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCA
GCGCGCAACTGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAA
CGGCCACGGGAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCG
CAAGGCATGCTGCTGACGACCTACGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGA
TTCGGTTGCTCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCA
GGCCGCGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGGCACG
GACGGCGCCGCTGCGCCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTCGG
TGAACGTCACGCCGAAGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCACCT
GCAACTGATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCGCG
GGGGTGCAGGCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAACG
CGCAGAAGGGCGTCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAAGATTCGGCTCGT
TGCCGAGGACGGCAGCTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGCTG
CTGTCGGCGTCGCACCAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCAGC
CGACGGATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAGCG
GTTCCGGATCACGCTGGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATCTG
GTCAAGGACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAACCGAAGCTCTGA