SecReT6
Effector Protein ID: 386865279
hcp-5
SecReT6 ID647
T6SS typeA1
Gene symbolhcp-5
Locus tagBP1026B_II1591
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2012534..2013043 [+]
Producttype VI secretion system
Effector typeProtein
Homologous effectorBMAA0742
DescriptionHcp protein
UniProt IDI1WU85
KEGG IDbpz:BP1026B_II1591
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|386865279|ref|YP_006278227.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFTYSGYSLEHAESGIAGAANWTNG
-
Nucleotide Sequence: 510 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2012534-2013043 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAAATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCTGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCACGTATTCGGGATACTCGTTGGAACACGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA