SecReT6
Effector Protein ID: 386865293
-
SecReT6 ID647
T6SS typeA1
Gene symbol-
Locus tagBP1026B_II1605
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2034995..2036218 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0729
Descriptionputative deubiquitinase
UniProt IDI1WU99
KEGG IDbpz:BP1026B_II1605
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 1.40E-10, Aligned region: 73..73
Big_5 [PF13205], Evalue: 1.40E-10, Aligned region: 109..208
UCH [PF00443], Evalue: 5.70E-08, Aligned region: 215..247
UCH [PF00443], Evalue: 5.70E-08, Aligned region: 356..388
Protein Sequence: 407 a.a.     [Download]
>gi|386865293|ref|YP_006278241.1| hypothetical protein BP1026B_II1605 [Burkholderia pseudomallei 1026b]
MRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAP
AAMPTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPG
SVPHIVLRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAP
VTPPRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALR
ATPEVPDSGPGQTLEVMQALRMPLYDTSSANNAKNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLV
AFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR
-
Nucleotide Sequence: 1224 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2034995-2036218 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCGCTCGCCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCG
GCGATTCGGGCGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACC
GAACTCGCCCGTCGCACCAGCGCCCACCGCGCACGTATCGAGCGGACACACGCCTCCGGCCACGGCGCCC
GCCGCGATGCCCACCGCTTCCCCCACCGCGACGCCCACCGCTTCACCCACCGCGACGGCTGCCGCTTCGC
CCTCCGCGCCATCCACTGCGACGCCCAACGCCCCGCCCGCCGCTCCGCCGGCCGTCGTCGCCACCCGCGT
CCCGCCGACGCACGCGGCGTTGCGCCGCCCGACGATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGT
TCAGTCCCACACATCGTGCTGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGA
GCGATCGCCGGATCGCGTTCGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCC
CGCCGGCATCAGGAGCACCACGGGCGAACGGTCGGCCCATCCGCTAACGAGCAGCTTCGATACCGCGCCC
GTTACGCCGCCGCGCGGCCTGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGG
CGGTTCACTCGTCGGCGCTCGACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCT
CGAAGACTACGACGCCGCATCGGCTGACGCACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGC
GCCACGCCGGAGGTCCCGGACAGCGGGCCGGGACAAACGCTGGAAGTGATGCAAGCGTTGCGGATGCCGT
TATATGACACGAGCAGCGCGAACAACGCAAAGAACAACGCCGACGCCATACGTCATGCGCCGCCCAACAC
CAAGGCGTTCTTTCTGAACTCCTATCCACCGCTTTCCTACGCGGATCTGCCGAACCACGACCGGCTCGTC
GCGTTCGACTACAGCACGGGCGGTCACTATGTCGCGTATGTGAAGCGGGATGGAATCTGGTATCGAATCG
ACGATGCCCAGGTCAGCGCCGTCAACGAACAGGACTTGCTTGCCCTGCCGGCGTTCAACCCCGCTAACGG
CAGCGTGTCGATCGAAATCGCGATCTATCGATGA