SecReT6
Effector Protein ID: 386865848
-
SecReT6 ID642
T6SS typeA4b
Gene symbol-
Locus tagBP1026B_II2176
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2701489..2702394 [+]
Productlectin
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDI1WVV4
KEGG IDbpz:BP1026B_II2176
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 87..134
B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 190..229
Protein Sequence: 301 a.a.     [Download]
>gi|386865848|ref|YP_006278796.1| lectin [Burkholderia pseudomallei 1026b]
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRFPTQAWGASAM
SQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGGY
PTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNL
PINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2701489-2702394 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAAAAAATACGCATTGGCGCTCTGGTTCATGCTGGTTTCATCGATGTCGGCAATGGCGGGGGCGATCA
TTCCATCGGGCGCAACGCTGGTTGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCATTCGGCGT
CGACGCCGCCAGCGGCAAGCTCTATTTCCACTACAGGTTCCCGACGCAGGCGTGGGGCGCGAGCGCGATG
TCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGCAGA
CCGACGGGCGGCTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGCGCC
GATCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCTATC
CGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGCCAATGGCTGCAGATCTTCAACAACGTCACTTACTA
CCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTGTCG
GCTTCGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCAGTC
GAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGCCGCCCTCGCTGAACCTG
CCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA