SecReT6
Effector Protein ID: 387124423
-
SecReT6 ID651
T6SS typeA4b
Gene symbol-
Locus tagABTJ_02412
StrainAcinetobacter baumannii MDR-TJ
Repliconchromosome [GenBank: NC_017847] [Browse all T6SS(s) in this replicon]
Location [Strand]2497117..2497620 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDI1Y274
KEGG IDabr:ABTJ_02412
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|387124423|ref|YP_006290305.1| type VI secretion system effector [Acinetobacter baumannii MDR-TJ]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|387122089|ref|NC_017847.1|:c2497620-2497117 Acinetobacter baumannii MDR-TJ chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA